Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr12510spoTXFF4834R_chr12510bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase
  2. XFF4834R_chr15200relAXFF4834R_chr15200(p)ppGpp synthetase I/GTP pyrophosphokinase

spoT XFF4834R_chr12510
XFF4834R_chr_1339
XFF4834R_chr_1339
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr12520
XFF4834R_chr12520
ID spoT
AC XFF4834R_chr12510
LT XFF4834R_chr12510
OR XFF4834R_chr from 1415039 to 1417210 on strand +
DE bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase
IP Metal-dependent phosphohydrolase, HD domain; RelA/SpoT protein; Beta-grasp fold, ferredoxin-type
CL 1.7.43 ppGpp biosynthesis
EC
GO InterPro
Biological Process: guanosine tetraphosphate metabolic process (GO:0015969)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN start codon changed Functional classes: Metabolism --> Central intermediary metabolism --> Nucleotide and nucleoside conversions ; Metabolism --> Central intermediary metabolism --> ppGpp biosynthesis ; Regulation --> Type of regulation --> Posttranscriptional --> Proteases, cleavage of compounds ; Cell processes --> Adaptation to stress --> Starvation response ; Location of gene products --> Cytoplasm
CC COG: [KT] Transcription;Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120330)
MW 80845.8 Da
SQ 723 aa
 
........10........20........30........40........50
| | | | |
MNPGPTAQATVVTSPSSDQAIPDYVLHLERAASYLPKEQLPILRRAWEVG
ATAHAGQTRKSGEPYITHPVAVAGVLAELGLDMESLIAAILHDTIEDTPL
TREELASEFGEAVAELVDGVTKLDKLKFRDRQEAAAESFRKMLLAMSRDL
RVIMIKLADRLHNMRTLGAQSTEARGRIARETLEIYAPIAQRLGMSLIKS
ELQNLGFRALYPWRHAIIEKHIRSQPVVRRESMAQVEVQLSQRLAKEGLE
HRLVSRIKTPWSIYSKMHEENKSFDQVMDVFGFRLVVRSVADCYHALGAV
HASFKPLDGRFRDFIAIPKANGYQSLHTVLFGPYGSPIEVQIRTEEMDLI
AERGVAAHWTYKVGSASPNSAQSRAHDWIVELIDSQRAAGSSLEFLDNVK
VDLFPDEVYLFTPKGKILALPRNSTALDFAYAVHTDVGNRAVASRVDKKL
VPLRTKLVSGQAVEIITARSATPKPQWLEFVVSSKARTAIRHQLKQLEHE
DAVQLGHRMLDRALEAMDSSLERLPKGRLDAFLNEHRYPRLEALLADVAL
GNWMPNQATQALMAYAELRGGGLSKHSHEKILIDGSERGVISFANCCQPI
PGDEIMGYHTAGKGIVVHRLDCPNLAELRKSPERWVPIDWDSNVTGDYGT
ALVVEVENRTGVLAQLAAAIAQSQSNIERVDYLDRDFNAAVLRFNIQVRD
RRHLAEVMRRLRRLHVVQSVGRQ
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr15200 lcl|relA-XFF4834R_chr15200

112

722

S=876 I=36 E=3.28346e-99

(p)ppGpp synthetase I/GTP pyrophosphokinase

XFF4834R

XFF4834R_chr33580 lcl|XFF4834R_chr36370714_3874352_r2_XFF4834R-XFF4834R_chr33580

53

167

S=150 I=34 E=2.84528e-11

XFF4834R

NP_643700.1 lcl|spoT-XAC3393

1

723

S=3745 I=98 E=0

pentaphosphate guanosine-3'-pyrophosphohydrolase

XFF4834R

YP_365241.1 lcl|spoT-XCV3510

1

723

S=3736 I=98 E=0

guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase

XFF4834R

NP_638593.1 lcl|spoT-XCC3247

1

723

S=3631 I=96 E=0

pentaphosphate guanosine-3'- pyrophosphohydrolase

XFF4834R

lcl|spoT-XALc_0799

1

723

S=3452 I=89 E=0

probable guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase protein

XFF4834R

NP_638284.1 lcl|relA-XCC2936

76

722

S=892 I=36 E=1.30539e-100

ATP:GTP 3'-pyrophosphotranferase

XFF4834R

YP_364975.1 lcl|relA-XCV3244

112

722

S=861 I=36 E=7.64385e-97

guanosine 3',5'-bis-pyrophosphate synthetase

XFF4834R

NP_643422.1 lcl|relA-XAC3113

112

722

S=861 I=36 E=8.41325e-97

ATP:GTP 3'-pyrophosphotranferase

XFF4834R

lcl|SpoT-XALc_2252

136

711

S=828 I=35 E=8.3124e-93

putative guanosine polyphosphate pyrophosphohydrolase/synthetase protein

XFF4834R

NP_641521.1 lcl|XAC1185-XAC1185

53

167

S=154 I=34 E=3.79746e-11

hypothetical protein

XFF4834R

YP_362942.1 lcl|XCV1211

53

167

S=150 I=34 E=1.035e-10

hypothetical protein

XFF4834R

NP_636462.1 lcl|XCC1087

53

167

S=145 I=34 E=4.3623e-10

hypothetical protein

Iprscan IPR012675 [G3DSA:3.10.20.30]

407

470

Beta-grasp fold, ferredoxin-type

Iprscan [PTHR21262]

136

723

-

Iprscan IPR007685 [PF04607]

255

363

RelA/SpoT

Iprscan IPR004095 [PF02824]

408

467

TGS

Iprscan IPR006674 [PF01966]

65

164

Metal-dependent phosphohydrolase, HD subdomain

Iprscan IPR003607 [SM00471]

61

173

Metal-dependent phosphohydrolase, HD domain

Iprscan IPR004811 [TIGR00691]

46

722

RelA/SpoT protein

Iprscan [seg]

663

675

-

Iprscan [SSF109604]

20

211

-

Iprscan [SSF81301]

212

385

-

Iprscan IPR012676 [SSF81271]

408

468

TGS-like

Iprscan [SSF55021]

639

723

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ReKWKbPV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

73 hits
swiss-prot

Swiss-Prot ncbi-blastp

51 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3n3rCD/XFF4834R_chr12510.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3n3rCD/XFF4834R_chr12510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3n3rCD/XFF4834R_chr12510.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3n3rCD/XFF4834R_chr12510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
relA XFF4834R_chr15200
XFF4834R_chr15190
XFF4834R_chr15190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15210
XFF4834R_chr15210
ID relA
AC XFF4834R_chr15200
LT XFF4834R_chr15200
OR XFF4834R_chr from 1741576 to 1743921 on strand +
DE (p)ppGpp synthetase I/GTP pyrophosphokinase
IP RelA/SpoT protein; RelA/SpoT; Beta-grasp fold, ferredoxin-type
CL 1.7.43 ppGpp biosynthesis
EC
GO InterPro
Biological Process: guanosine tetraphosphate metabolic process (GO:0015969)

Curated
PM
AN
CC COG: [KT] Transcription;Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 86552.4 Da
SQ 781 aa
 
........10........20........30........40........50
| | | | |
MPRRVAFRAGRLRIKTLPGEPGISTRVVSRGERLGKTRCGEGDAHVTVVV
SPLLLPTAVSTAVTSSSFDRLQALLQRPAVASIAPAVRDALAQAWQELPP
AQIGDVPWALLGDTLDALALLAADEATLIAALLFDLPALRGVIAGLPWQP
AERRVAVEGLLDGLDAADQVWALHAGREAGRNSEGLRRLLLSIIHDLRVV
PILLARQLARMRVADRLSEDERRALAQLTRDIHAPLANRLGIWQVKWELE
DLAFRHLEPETYRRIAREVDETRVARERYLEAVKRTLSAALAQQGLRAEV
SGRPKHIYSIWRKMQKKRLSFDQLYDIRAVRVMVDDVAACYAALGAVHSL
WAPVPSEFDDYIARPKANDYRSLHTAVVGPEGRTIEIQIRTFEMHAQAEL
GVAAHWKYKEGGKGGEKAFDRKILWMRQLLEQVQEGEHGELAGALDAELI
EDRVYALTPKGEVIDLPQGATPLDFAYHVHTMVGHRCRGARVNDRIVPLT
YRLRSGDRVEIMTAKEADPRRDWLLASNGFLASGRSRDKVRAWFHKLDRA
RNVQAGKDLLDRELKRLGLQHADLSVAARKFHAENIDELYIQVALGDTGP
NQVSRALLEAERAASQPAVPAPPRPTARRDGLGKSKFTVEGVGNLLVQLA
RCCQPVAGEPIAGYLTRGRGITVHRTDCTALARLAAAHPQRVLPVEWGKA
GSGYEVDVQVRAVDRRWLLKDITNLIAQEDAHVLEINSDNVRDTGRAQLR
LRLKVSDYGQLSGLLGKLDALPEVSEVRRLG
XFF4834R

XFF4834R_chr12510 lcl|spoT-XFF4834R_chr12510

156

779

S=827 I=35 E=2.76425e-93

bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase

XFF4834R

NP_643422.1 lcl|relA-XAC3113

68

781

S=3210 I=90 E=0

ATP:GTP 3'-pyrophosphotranferase

XFF4834R

YP_364975.1 lcl|relA-XCV3244

68

781

S=3198 I=89 E=0

guanosine 3',5'-bis-pyrophosphate synthetase

XFF4834R

NP_638284.1 lcl|relA-XCC2936

69

781

S=3071 I=84 E=0

ATP:GTP 3'-pyrophosphotranferase

XFF4834R

lcl|SpoT-XALc_2252

71

781

S=2582 I=75 E=0

putative guanosine polyphosphate pyrophosphohydrolase/synthetase protein

XFF4834R

lcl|spoT-XALc_0799

151

779

S=835 I=35 E=1.19916e-93

probable guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase protein

XFF4834R

YP_365241.1 lcl|spoT-XCV3510

156

779

S=830 I=36 E=4.0999e-93

guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase

XFF4834R

NP_643700.1 lcl|spoT-XAC3393

156

779

S=830 I=35 E=4.39608e-93

pentaphosphate guanosine-3'-pyrophosphohydrolase

XFF4834R

NP_638593.1 lcl|spoT-XCC3247

156

779

S=820 I=35 E=6.91196e-92

pentaphosphate guanosine-3'- pyrophosphohydrolase

pubmed

184

780

S=1342 I=45 E=1.53914e-153

GTP pyrophosphokinase EC=2.7.6.5 ; ATP-binding GTP-binding Nucleotide-binding Transferase

Pubmed 7928955

 

prodomImg

pubmed

157

780

S=1338 I=43 E=4.5771e-153

GTP pyrophosphokinase EC=2.7.6.5 ; ATP-binding GTP-binding Nucleotide-binding Transferase

Pubmed 2844820

 

prodomImg

pubmed

164

780

S=1190 I=38 E=4.35428e-135

GTP pyrophosphokinase EC=2.7.6.5 ; Transferase

Pubmed 12446909

 

prodomImg

pubmed

157

780

S=1142 I=37 E=2.63578e-129

Rel

Pubmed 11916666

 

prodomImg

pubmed

164

780

S=1126 I=36 E=2.63138e-127

PpGpp synthetase/hydrolase Rel

Pubmed 11034279

 

prodomImg

pubmed

164

780

S=1054 I=34 E=1.33462e-118

GTP pyrophosphokinase EC=2.7.6.5 ; ATP-binding GTP-binding Nucleotide-binding Transferase

Pubmed 9383190

 

prodomImg

pubmed

181

780

S=1049 I=36 E=5.02236e-118

Guanosine polyphosphate pyrophosphohydrolases/synthetases

Pubmed 16309397

 

prodomImg

pubmed

164

779

S=1035 I=35 E=2.97161e-116

Pp(P)Gpp synthetase/hydrolase

Pubmed 18513216

 

prodomImg

pubmed

181

780

S=1034 I=35 E=3.63146e-116

GTP pyrophosphokinase EC=2.7.6.5 ; ATP-binding GTP-binding Nucleotide-binding Transferase

Pubmed 9335275

 

prodomImg

pubmed

160

780

S=1021 I=38 E=1.50286e-114

PpGpp synthetase

Pubmed 15133110

 

prodomImg

sp_Pdown

sp|P55133|RELA_VIBSS

184

780

S=1342 I=45 E=1.05986e-153

GTP pyrophosphokinase EC=2.7.6.5 ; ATP-binding GTP-binding Nucleotide-binding Transferase

sp_Pdown

sp|P0AG23|RELA_SHIFL

157

780

S=1338 I=43 E=3.15182e-153

GTP pyrophosphokinase EC=2.7.6.5 ; ATP-binding GTP-binding Nucleotide-binding Transferase

Iprscan IPR012675 [G3DSA:3.10.20.30]

453

516

Beta-grasp fold, ferredoxin-type

Iprscan IPR007685 [PF04607]

302

412

RelA/SpoT

Iprscan IPR004095 [PF02824]

454

513

TGS

Iprscan IPR004811 [TIGR00691]

109

779

RelA/SpoT protein

Iprscan [seg]

46

67

-

Iprscan [seg]

109

133

-

Iprscan [seg]

328

339

-

Iprscan [seg]

407

417

-

Iprscan [seg]

612

629

-

PD002902

297

431

S=403 I=58 E=3.68062e-41

PD292158

71

182

S=368 I=71 E=6.57909e-37

PD334556

157

257

S=224 I=49 E=1.70727e-19

PD003989

647

705

S=181 I=53 E=2.91912e-14

PD471591

437

491

S=180 I=56 E=4.7566e-14

PD789417

489

556

S=165 I=45 E=2.49098e-12

PD688230

418

448

S=156 I=100 E=3.20491e-11

PDA4S9D3

17

45

S=112 I=72 E=6.87408e-06

PD926321

551

609

S=109 I=37 E=1.9065e-05

PDA1V227

604

646

S=108 I=58 E=2.32984e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one qJkxSP2b)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

67 hits
swiss-prot

Swiss-Prot ncbi-blastp

40 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3n3rCD/XFF4834R_chr15200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3n3rCD/XFF4834R_chr15200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3n3rCD/XFF4834R_chr15200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3n3rCD/XFF4834R_chr15200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.