Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr19840XFF4834R_chr21310328_2277894_r1_XFF4834R-XFF4834R_chr19840XFF4834R_chr19840acireductone dioxygenase family protein

XFF4834R_chr21310328_2277894_r1_XFF4834R-XFF4834R_chr19840 XFF4834R_chr19840
XFF4834R_chr19830
XFF4834R_chr19830
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19850
XFF4834R_chr19850
ID XFF4834R_chr21310328_2277894_r1_XFF4834R-XFF4834R_chr19840
AC XFF4834R_chr19840
LT XFF4834R_chr19840
OR XFF4834R_chr from 2277328 to 2277894 on strand -
DE acireductone dioxygenase family protein
IP Acireductone dioxygenase, ARD; RmlC-like jelly roll fold
CL 1.7.38 Methionine salvage pathway GO:0019509
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: methionine salvage (GO:0019509)
Molecular Function: metal ion binding (GO:0046872)
Molecular Function: dioxygenase activity (GO:0051213)

Curated
PM
AN idem xav
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 21230.7 Da
SQ 188 aa
 
........10........20........30........40........50
| | | | |
MSRLRIFADTNPATPEFDSRDGDAIAAELVKIGVTFERWHASAPVEPGAT
PEQVMDAYRADIDRISAERGFKTVDVVSIAPDNPKREEMRAKFLDEHFHK
EDEVRFFVAGSGLFTLHVDAKVYEIECVKDDLIAVPDGTLHWFDMGPEPH
FVAIRFFTEPDGWVGHFTGTEIAKQFPRYAPEKPHKAS
Show or not Domain decomposition
 
XFF4834R

NP_642165.1 lcl|XAC1839-XAC1839

1

188

S=981 I=99 E=4.12657e-112

dioxygenase

XFF4834R

YP_363616.1 lcl|XCV1885

1

188

S=977 I=99 E=1.09567e-111

acireductone dioxygenase family protein

XFF4834R

NP_637184.1 lcl|XCC1819

1

188

S=923 I=93 E=4.84166e-105

dioxygenase

XFF4834R

lcl|XALc_1321

1

187

S=793 I=79 E=2.35768e-89

putative acireductone dioxygenase family oxidoreductase protein

pubmed

1

180

S=526 I=54 E=1.86183e-55

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

Pubmed 16563686

 

prodomImg

pubmed

1

180

S=477 I=48 E=1.78903e-49

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

Pubmed 8227040,9880484

 

prodomImg

pubmed

1

178

S=450 I=49 E=2.8082e-46

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

Pubmed 17965706

 

prodomImg

pubmed

1

181

S=417 I=45 E=2.75045e-42

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

Pubmed 10518757

 

prodomImg

pubmed

52

164

S=237 I=38 E=2.22906e-20

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

Pubmed 12022921

 

prodomImg

pubmed

56

164

S=147 I=30 E=1.65645e-09

Acireductone dioxygenase

Pubmed 18776203

 

prodomImg

pubmed

56

164

S=146 I=30 E=2.18951e-09

1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase EC=1.13.-.- ; Amino-acid biosynthesis Cell membrane Metal-binding Methionine Nickel Nucleus Oxi

Pubmed 14684610

 

prodomImg

pubmed

56

166

S=143 I=30 E=4.6749e-09

1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase EC=1.13.-.- ; Alternative splicing Amino-acid biosynthesis Cell membrane Metal-binding Methi

Pubmed 14718544,15221005

 

prodomImg

pubmed

56

164

S=139 I=27 E=1.62646e-08

Aci-reductone dioxygenase-like protein

Pubmed 18507865

 

prodomImg

pubmed

61

163

S=138 I=29 E=2.00502e-08

1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 EC=1.13.-.- ; Alternative splicing Amino-acid biosynthesis Iron Metal-binding Methionine O

Pubmed 9461215

 

prodomImg

sp_Pdown

sp|Q8PLG1|MTND_XANAC

1

188

S=981 I=99 E=9.88069e-111

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

sp_Pdown

sp|Q3BUE7|MTND_XANC5

1

188

S=977 I=99 E=2.62347e-110

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

sp_Pdown

sp|Q5H0X9|MTND_XANOR

1

188

S=971 I=98 E=1.56715e-109

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

sp_Pdown

sp|B2SM83|MTND_XANOP

1

188

S=971 I=98 E=1.56715e-109

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

sp_Pdown

sp|Q2P3W5|MTND_XANOM

1

188

S=971 I=98 E=1.56715e-109

Acireductone dioxygenase EC=1.13.11.53 EC=1.13.11.54 ; Amino-acid biosynthesis Iron Metal-binding Methionine Nickel Oxidoreductase

PD093863

29

96

S=225 I=61 E=8.16112e-20

PDA8L734

1

176

S=217 I=31 E=7.7387e-19

PD006219

97

145

S=155 I=62 E=2.49636e-11

PDA1G816

144

178

S=154 I=77 E=3.60032e-11

PD652739

97

172

S=132 I=32 E=1.48873e-08

PDA1V300

1

28

S=117 I=79 E=1.21619e-06

PD953660

144

171

S=102 I=71 E=6.42481e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ykNZQmtv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

122 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBb7V5wI/XFF4834R_chr19840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBb7V5wI/XFF4834R_chr19840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBb7V5wI/XFF4834R_chr19840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBb7V5wI/XFF4834R_chr19840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.