Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr00970XFF4834R_chr00970XFF4834R_chr00970putative trehalose synthase
  2. XFF4834R_chr04210glgYXFF4834R_chr04210probable maltooligosyl trehalose synthase
  3. XFF4834R_chr14160otsAXFF4834R_chr14160probable trehalose-6-phosphate synthase
  4. XFF4834R_chr14180otsBXFF4834R_chr14180probable trehalose-6-phosphate phosphatase

XFF4834R_chr00970 XFF4834R_chr00970
XFF4834R_chr00960
XFF4834R_chr00960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00980
XFF4834R_chr00980
ID XFF4834R_chr00970
AC XFF4834R_chr00970
LT XFF4834R_chr00970
OR XFF4834R_chr from 115453 to 118803 on strand -
DE putative trehalose synthase
IP Glycosyl hydrolase, family 13, catalytic domain; Protein kinase-like domain; Trehalose synthase/alpha-amylase, N-terminal; Trehalose synthase/probable maltokinase, C-terminal; Glycoside hydrolase, catalytic core
CL 1.7.36 Trehalose biosynthesis GO:0005992
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)

Curated
PM
AN treS
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110119)
MW 125552.5 Da
SQ 1116 aa
 
........10........20........30........40........50
| | | | |
MNAVASLQADAEQSAVVADQRWYKDAIIYQVHVKSFFDSNDDGIGDFPGL
ISKLDYIAELGVDTIWLLPFYPSPRRDDGYDIAEYMAVHPDYGSIEDFEQ
LVAQAHARGIRIVTELVINHTSDQHPWFQRARNAPAGSPERDFYVWSDTD
QEYEGTRIIFCDTEKSNWTWDPVAGQYFWHRFYSHQPDLNFDNPAVLEAV
LEVMRFWLDRGVDGLRLDAVPYLIERAGTSNENLPETHAILRKIRATLDA
EYPDRMLLAEANMWPEDTQQYFGQNADECHMAFHFPLMPRMYMAIAREDR
FPITDIMRQTPEIPESCQWAIFLRNHDELTLEMVTDSERDYLWQTYAADR
RARINLGIRRRLAPLLERDRRRIELMTSLLLTMPGTPVLYYGDEIGMGDN
IHLGDRDGVRTPMQWSIDRNGGFSRADPAQLVLPPVMDPLYGFQAVNVEA
QIRDQHSLLTWTRRVLSVRKRYQAFGRGSLRFLYPGNRRMLAYLRCYQDE
TVLCVANLSHTLQAVELDLSEFEGRVPVDIIGGGSFPPIGRLTYLLTVPP
FGFYAFQLVSEGTLPDWHVPSPVPLPDYRTLVLRSDADESAALLPHLPTL
EGEILPAWLSARRWFSAKDQALRSVRIARRTPLPGDEPMTLLELEVELED
GRHERYMLPVGIVWEREQPSTLAEQLALARVRQGREVGYLTDAFALKPMV
RGVIDALRSHAALDFCDGDDASQQGQVCFEATPALATLDIPQDPEIRWLS
AEQSNSSLVVADKAVFKLLRHVAVGANPEIEIGRRLTEMGYANAAPLLGS
VSRIDGQGTVTTIALLQGFIRNQGDAWRWTLDHLARSFDEYATAQTDEAR
AEAVAGYDAFAAVVGKRLAELHEALSRVTDDADFAPQRIDLPTANDVVAG
VGRQVEEMWETVNARLAGSEDSAEREALEAVLAERPQLDALLARAPSVLA
DSLLTRVHGDFHLGQILVAFDDVVLIDFEGEPAKPLAERRAKASPLRDVA
GFLRSLDYASEVSARGEEGTAARAGVGVDTHLDQFLVQFRRRSTQAFLDA
YHAVLDASAHPWIAPAAFNAATLLFLVEKACYEVRYEAANRPGWLMVPIE
GLRRILQRARAGAGDT
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr11570 lcl|XFF4834R_chr12030020_1290939_r1_XFF4834R-XFF4834R_chr11570

32

329

S=405 I=32 E=5.77237e-42

XFF4834R

XFF4834R_chr04190 lcl|XFF4834R_chr04330084_0477841_f2_XFF4834R-XFF4834R_chr04190

21

120

S=112 I=29 E=2.03734e-06

XFF4834R

NP_640511.1 lcl|XAC0155-XAC0155

1

1116

S=5596 I=95 E=0

trehalose synthase

XFF4834R

YP_361871.1 lcl|XCV0140

1

1116

S=5554 I=96 E=0

putative trehalose synthase

XFF4834R

NP_635529.1 lcl|XCC0134

1

1116

S=5414 I=92 E=0

trehalose synthase

XFF4834R

YP_364534.1 lcl|aglA-XCV2803

22

227

S=529 I=47 E=1.77057e-56

alpha-glucosidase

XFF4834R

NP_637823.1 lcl|aglA-XCC2471

22

227

S=528 I=47 E=2.81059e-56

alpha-glucosidase

XFF4834R

NP_637823.1 lcl|aglA-XCC2471

375

523

S=119 I=29 E=1.0886e-06

alpha-glucosidase

XFF4834R

NP_642915.1 lcl|aglA-XAC2602

22

294

S=525 I=40 E=6.00101e-56

alpha-glucosidase

XFF4834R

NP_638705.1 lcl|XCC3359

45

329

S=420 I=35 E=2.90413e-43

amylosucrase or alpha amylase

XFF4834R

NP_643797.1 lcl|XAC3490-XAC3490

30

334

S=410 I=32 E=5.15896e-42

amylosucrase or alpha amylase

XFF4834R

YP_365349.1 lcl|suh-XCV3618

32

329

S=406 I=32 E=1.65941e-41

sucrose hydrolase

XFF4834R

lcl|suxB-XALc_0730

45

336

S=377 I=32 E=5.4179e-38

probable sucrose hydrolase protein

XFF4834R

YP_362184.1 lcl|XCV0453

2

120

S=117 I=30 E=1.74317e-06

alpha-amylase family protein

XFF4834R

lcl|glgB-XALc_2592

21

120

S=113 I=30 E=4.96272e-06

putative 1,4-alpha-glucan branching enzyme protein

XFF4834R

NP_640782.1 lcl|XAC0427-XAC0427

21

120

S=110 I=28 E=1.27251e-05

maltooligosyltrehalose trehalohydrolase

XFF4834R

NP_635804.1 lcl|XCC0410

21

120

S=108 I=28 E=1.96783e-05

maltooligosyltrehalose trehalohydrolase

Iprscan IPR013781 [G3DSA:3.20.20.80]

18

478

Glycoside hydrolase, subgroup, catalytic core

Iprscan [PTHR10357:SF11]

19

532

-

Iprscan [PTHR10357]

19

532

-

Iprscan IPR006047 [PF00128]

45

399

Glycosyl hydrolase, family 13, catalytic domain

Iprscan IPR006589 [SM00642]

30

430

Glycosyl hydrolase, family 13, subfamily, catalytic domain

Iprscan IPR012810 [TIGR02456]

21

559

Trehalose synthase/alpha-amylase, N-terminal

Iprscan IPR012811 [TIGR02457]

574

1106

Trehalose synthase/probable maltokinase, C-terminal

Iprscan [seg]

350

363

-

Iprscan [seg]

923

935

-

Iprscan [seg]

1014

1028

-

Iprscan IPR017853 [SSF51445]

27

479

Glycoside hydrolase, catalytic core

Iprscan [SSF51011]

478

558

-

Iprscan IPR011009 [SSF56112]

859

1075

Protein kinase-like domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CIuO14pK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

306 hits
swiss-prot

Swiss-Prot ncbi-blastp

103 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr00970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr00970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr00970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr00970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
glgY XFF4834R_chr04210
XFF4834R_chr04200
XFF4834R_chr04200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04220
XFF4834R_chr04220
ID glgY
AC XFF4834R_chr04210
LT XFF4834R_chr04210
OR XFF4834R_chr from 479784 to 482396 on strand +
DE probable maltooligosyl trehalose synthase
IP Malto-oligosyltrehalose synthase; Glycoside hydrolase, subgroup, catalytic core; Glycoside hydrolase, catalytic core
CL 1.7.36 Trehalose biosynthesis GO:0005992
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)

Curated
PM
AN trehalose synthesis
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110104)
MW 96099 Da
SQ 870 aa
 
........10........20........30........40........50
| | | | |
MIDLRATARLQLHAGFTLHDALAQVPYYAGLGISHLYLSPIGTAVPGSTH
GYDNIDPTVVNPELGGEDALVALSQAAREHGMGLIADIVPNHMATHVQNA
WWWDVLRNGRSAKHADWFDIDWRAPGRDGKLWLAVLDRPYATALAEGLIT
LVIDDDDGSAALAHYDQRYPIRPQTLDIPERAARAQWLRDYNDGAKRGDG
RLHKLIERQPYRLNWWRVGNDMLNYRRFFDITSLVALRVELPAVFDAVHA
LPLRLVAEGHLDGLRIDHVDGLTDPTGYVRKLRSRLDAAGRTRGLKPGTL
GLYLEKILAPGEHLPADWPCDGTTGYDFMDQVGGLLHGAAGFKPLARAWQ
KVSGRSGDFAQEERTARDEILRGPLQSEFNRAVGALSALARLDPPTREFS
PQMLARGLCVLLRWFPVYRTYAGAKGITGSEAERLRATAAKAREGMPESI
VAAVDAIERWLLDDAGADRAQIALRRILRRRVEQLSAPLNAKSVEDTAFY
RHGVLLSRNEVGSHPTHFANDAAEFHAQNLERAKHYPRALLATATHDHKR
GEDLRMRLAVLSEQPRWWIEQSAQFDALADALQSPALAGGDQQMLWQTLV
AAWPIGLGADQTEPLADYAERIAQWLLKAVREAKLHTSWTDGSPAYEQAV
QATVEQVLCSRAGLPLRRALLRASNHIAAAGARNSLVQTTLRLTVPGVPD
LYQGTEGWDLSLVDPDNRRPVDYAQRQQWLQQARDFSGLLRSWRDGAVKA
RLTALLLQVRREFPALFAKGDYQPLNIAISGDAQVLAFRRQYRGQSLVVA
VTRLGAGVEGEGDLPLLLAPAAWGQASLALGEGTYRNVLDGSTLQPQRGR
VALSTLFARAPVAVLLSQDN
XFF4834R

XFF4834R_chr11570 lcl|XFF4834R_chr12030020_1290939_r1_XFF4834R-XFF4834R_chr11570

17

94

S=117 I=39 E=3.34133e-07

XFF4834R

XFF4834R_chr04190 lcl|XFF4834R_chr04330084_0477841_f2_XFF4834R-XFF4834R_chr04190

23

93

S=107 I=39 E=4.81492e-06

XFF4834R

NP_640784.1 lcl|glgY-XAC0429

1

870

S=4247 I=94 E=0

maltooligosyltrehalose synthase

XFF4834R

YP_362186.1 lcl|glgY-XCV0455

1

870

S=4221 I=93 E=0

maltooligosyltrehalose synthase

XFF4834R

NP_635806.1 lcl|glgY-XCC0412

1

867

S=3892 I=87 E=0

maltooligosyltrehalose synthase

XFF4834R

lcl|glgY-XALc_2594

1

865

S=2445 I=60 E=0

putative maltooligosyl trehalose synthase protein

XFF4834R

YP_364534.1 lcl|aglA-XCV2803

22

129

S=121 I=32 E=4.06146e-07

alpha-glucosidase

XFF4834R

NP_643797.1 lcl|XAC3490-XAC3490

17

94

S=121 I=42 E=4.13291e-07

amylosucrase or alpha amylase

XFF4834R

NP_642915.1 lcl|aglA-XAC2602

22

129

S=120 I=32 E=5.75629e-07

alpha-glucosidase

XFF4834R

YP_365349.1 lcl|suh-XCV3618

17

94

S=117 I=41 E=1.14624e-06

sucrose hydrolase

XFF4834R

NP_635804.1 lcl|XCC0410

23

93

S=109 I=39 E=1.09643e-05

maltooligosyltrehalose trehalohydrolase

XFF4834R

YP_362184.1 lcl|XCV0453

23

93

S=109 I=39 E=1.29397e-05

alpha-amylase family protein

XFF4834R

NP_637823.1 lcl|aglA-XCC2471

22

129

S=108 I=32 E=1.41186e-05

alpha-glucosidase

XFF4834R

NP_640782.1 lcl|XAC0427-XAC0427

23

93

S=107 I=39 E=1.88254e-05

maltooligosyltrehalose trehalohydrolase

XFF4834R

NP_638705.1 lcl|XCC3359

17

94

S=106 I=39 E=2.91119e-05

amylosucrase or alpha amylase

pubmed

6

866

S=1039 I=37 E=1.1085e-116

Maltooligosyl trehalose synthase

Pubmed 8829547

 

prodomImg

pubmed

6

868

S=1037 I=37 E=1.72921e-116

Maltooligosyl trehalose synthase EC=5.4.99.15 ; Isomerase

Pubmed 8605217,8611744

 

prodomImg

pubmed

6

865

S=953 I=37 E=3.1296e-106

Putative maltooligosyltrehalose synthase

Pubmed 16381882,17295914

 

prodomImg

pubmed

6

868

S=924 I=35 E=1.0218e-102

TreY

Pubmed 18663442

 

prodomImg

pubmed

202

801

S=907 I=37 E=1.10336e-100

Maltoologosyl trehalose synthase

Pubmed 16052332

 

prodomImg

sp_Pdown

sp|Q44315|TREY_ARTSQ

6

868

S=1037 I=37 E=1.17737e-116

Maltooligosyl trehalose synthase EC=5.4.99.15 ; Isomerase

sp_Pdown

sp|Q10768|TREY_MYCTU

482

870

S=480 I=37 E=3.80636e-49

Putative maltooligosyl trehalose synthase EC=5.4.99.15 ; Isomerase

sp_Pdown

sp|Q10768|TREY_MYCTU

15

136

S=354 I=60 E=7.22866e-34

Putative maltooligosyl trehalose synthase EC=5.4.99.15 ; Isomerase

sp_Pdown

sp|Q10768|TREY_MYCTU

198

345

S=276 I=47 E=2.13357e-24

Putative maltooligosyl trehalose synthase EC=5.4.99.15 ; Isomerase

sp_Pdown

sp|P29964|CDAS_THEP3

18

122

S=156 I=33 E=6.96275e-10

Cyclomaltodextrinase EC=3.2.1.54 ; Calcium Glycosidase Hydrolase Metal-binding

Iprscan IPR013781 [G3DSA:3.20.20.80]

3

771

Glycoside hydrolase, subgroup, catalytic core

Iprscan [PTHR10357:SF10]

25

325

-

Iprscan [PTHR10357]

25

325

-

Iprscan IPR006047 [PF00128]

24

119

Glycosyl hydrolase, family 13, catalytic domain

Iprscan IPR006589 [SM00642]

7

443

Glycosyl hydrolase, family 13, subfamily, catalytic domain

Iprscan IPR012767 [TIGR02401]

4

867

Malto-oligosyltrehalose synthase

Iprscan [seg]

469

481

-

Iprscan [seg]

661

673

-

PD608652

93

268

S=384 I=48 E=6.61565e-39

PD654395

593

735

S=382 I=53 E=1.05936e-38

PD011989

482

578

S=269 I=56 E=5.78741e-25

PDA2S6Z6

202

285

S=232 I=51 E=1.68567e-20

PD397899

329

464

S=224 I=40 E=1.7289e-19

PD910013

178

217

S=211 I=98 E=6.27784e-18

PD493705

746

868

S=194 I=46 E=8.00032e-16

PD608239

1

40

S=131 I=70 E=3.15381e-08

PDA0Z2N6

206

266

S=130 I=43 E=4.31669e-08

PDA1G0F1

302

330

S=128 I=76 E=7.74188e-08

Iprscan IPR017853 [SSF51445]

4

770

Glycoside hydrolase, catalytic core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UHzOIsgT)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

70 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr04210.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr04210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr04210.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr04210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
otsA XFF4834R_chr14160
XFF4834R_chr14150
XFF4834R_chr14150
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14170
XFF4834R_chr14170
ID otsA
AC XFF4834R_chr14160
LT XFF4834R_chr14160
OR XFF4834R_chr from 1621147 to 1622514 on strand -
DE probable trehalose-6-phosphate synthase
IP Glycosyl transferase, family 20
CL 1.7.36 Trehalose biosynthesis GO:0005992
EC
GO InterPro
Biological Process: trehalose biosynthetic process (GO:0005992)
Molecular Function: catalytic activity (GO:0003824)
alpha-trehalose-phosphate synthase (UDP-forming) activity (GO:0003825)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 50812.4 Da
SQ 455 aa
 
........10........20........30........40........50
| | | | |
MSRLVVVSNRVAVPGENRAGGLAVGLLAALKERGGVWFGWSGKTVRGDSG
GMHEQTEGDITFVTMDLNKRDIDSYYNGFANRTLWPLLHFRLDLVDYDRA
TREGYMRVNRLFAEKLAPLLKDSDTLWIHDYHMIPLGAMLRELGVGCKMG
FFLHVPMPSADLVQAMPDHARLFSTFYAYDLVGFQTQRDAERFKAYVRLF
GGGRILEGDLVEGPGGRRFTASSFPIGIDTDLIAHQAKASAGKQAVRDLR
ESLRGRQLAIGVDRLDYSKGLPERFQGFERYLERYPDQSGSLTYLQIAPV
SRGDVTEYRQLRSQLEQIAGHINGGHAEPDWTPLRYVNQNFSHATLTGFY
RAASVCLVTPLRDGMNLVAKEFVAAQDPADPGVLVLSLFAGAADEMKEAL
LVNPHDLDGVADAIATAASMPLASRIERWHAMMDHLRKNNINHWRQRYLQ
ALSEV
Show or not Domain decomposition
 
XFF4834R

NP_643519.1 lcl|ostA-XAC3211

1

455

S=2350 I=97 E=0

trehalose-6-phosphate synthase

XFF4834R

YP_365067.1 lcl|ostA2-XCV3336

1

455

S=2340 I=97 E=0

trehalose-6-phosphate synthase

XFF4834R

NP_638429.1 lcl|ostA-XCC3082

1

455

S=2249 I=92 E=0

trehalose-6-phosphate synthase

XFF4834R

lcl|otsA-XALc_0697

1

453

S=1914 I=78 E=0

probable trehalose-6-phosphate synthase protein

XFF4834R

NP_638382.2 lcl|XCC3035

35

453

S=562 I=33 E=8.61284e-61

alpha,alpha-trehalose-phosphate synthase

pubmed

1

454

S=1145 I=49 E=8.35043e-130

Trehalose-phosphate synthase

Pubmed 16052332

 

prodomImg

pubmed

1

455

S=1122 I=47 E=4.00455e-127

Trehalose-6-phosphate synthase EC=2.4.1.15 ; Glycosyltransferase

Pubmed 18533836

 

prodomImg

pubmed

1

452

S=1121 I=48 E=6.30162e-127

OtsA

Pubmed 17449695

 

prodomImg

pubmed

1

455

S=1032 I=47 E=3.96794e-116

Alpha,alpha-trehalose-phosphate synthase [UDP-forming] EC=2.4.1.15 ; Glycosyltransferase Potassium Stress response

Pubmed 8045430

 

prodomImg

pubmed

1

455

S=1026 I=47 E=1.87311e-115

Alpha,alpha-trehalose-phosphate synthase [UDP-forming] EC=2.4.1.15 ; Glycosyltransferase

Pubmed 17209814

 

prodomImg

sp_Pdown

sp|A6TB47|OTSA_KLEP7

1

455

S=1105 I=48 E=3.38071e-125

Alpha,alpha-trehalose-phosphate synthase [UDP-forming] EC=2.4.1.15 ; Glycosyltransferase

sp_Pdown

sp|P55612|OTSA_RHISN

1

453

S=1093 I=47 E=1.03114e-123

Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] EC=2.4.1.15 ; Glycosyltransferase Plasmid

sp_Pdown

sp|A4WBR1|OTSA_ENT38

1

453

S=1089 I=47 E=3.06641e-123

Alpha,alpha-trehalose-phosphate synthase [UDP-forming] EC=2.4.1.15 ; Glycosyltransferase

sp_Pdown

sp|A7MEE9|OTSA_ENTS8

1

455

S=1089 I=47 E=3.49485e-123

Alpha,alpha-trehalose-phosphate synthase [UDP-forming] EC=2.4.1.15 ; Glycosyltransferase

sp_Pdown

sp|Q57N70|OTSA_SALCH

1

455

S=1087 I=47 E=5.31105e-123

Alpha,alpha-trehalose-phosphate synthase [UDP-forming] EC=2.4.1.15 ; Glycosyltransferase

Iprscan [G3DSA:3.40.50.2000]

1

248

-

Iprscan [PTHR10788]

56

455

-

Iprscan IPR001830 [PF00982]

16

453

Glycosyl transferase, family 20

Iprscan IPR012766 [TIGR02400]

3

454

Alpha,alpha-trehalose-phosphate synthase

PD002868

10

452

S=861 I=41 E=7.50937e-97

PDA1C298

125

260

S=139 I=29 E=2.58242e-09

Iprscan [SSF53756]

2

455

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one NDev7cYj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

77 hits
swiss-prot

Swiss-Prot ncbi-blastp

80 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr14160.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr14160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr14160.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr14160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
otsB XFF4834R_chr14180
XFF4834R_chr14170
XFF4834R_chr14170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14190
XFF4834R_chr14190
ID otsB
AC XFF4834R_chr14180
LT XFF4834R_chr14180
OR XFF4834R_chr from 1624336 to 1625094 on strand -
DE probable trehalose-6-phosphate phosphatase
IP HAD-superfamily hydrolase, subfamily IIB
CL 1.7.36 Trehalose biosynthesis GO:0005992
EC
GO InterPro
Biological Process: trehalose biosynthetic process (GO:0005992)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110112)
MW 27136.4 Da
SQ 252 aa
 
........10........20........30........40........50
| | | | |
MADAQSPLPSPPLLDDACALFLDVDGTLIDFADRPEAVQLLPEVREAIGL
LSERFKGAVALVSGRPLAQLDALFAPLRLPAAGLHGHELRSDLATRAAMP
HDTSQWLHGLHQRAAALTHQHPGVLVEDKGASVALHWRARPQAGPEVLAF
AQQEIAQLSGYRLQPGDHVVEFVPEGSNKGLAVEQLMQHGTFAGRTPVFV
GDDLTDEFGFDAANRLGGWSVLVGDRAQTSARFRVGGIADVHAWLQRNAR
SR
XFF4834R

NP_643517.1 ostB-XAC3209

21

252

S=1141 I=97 E=2.7976e-131

trehalose-6-phosphate phosphatase

XFF4834R

YP_365065.1 ostB-XCV3334

21

252

S=1137 I=96 E=8.10475e-131

trehalose-phosphatase

XFF4834R

NP_638427.1 ostB-XCC3080

21

251

S=1019 I=87 E=1.71036e-116

trehalose-6-phosphate phosphatase

XFF4834R

XALc_0699 XALc_0699

21

249

S=776 I=68 E=4.35598e-87

putative trehalose-phosphatase protein

pubmed

21

246

S=407 I=41 E=8.05229e-41

Trehalose-phosphate phosphatase EC=3.1.3.12 ; Hydrolase

Pubmed 8045430

 

prodomImg

pubmed

21

246

S=402 I=40 E=3.24908e-40

Trehalose-6-phosphate phosphatase

Pubmed 17209814

 

prodomImg

pubmed

21

250

S=188 I=36 E=2.88854e-14

Trehalose-phosphate phosphatase

Pubmed 14526004

 

prodomImg

pubmed

21

247

S=184 I=29 E=8.29556e-14

Ramosa 3-like protein

Pubmed 16688177

 

prodomImg

pubmed

21

250

S=180 I=36 E=2.9369e-13

Trehalose-phosphate phosphatase

Pubmed 15870334

 

prodomImg

sp_Pdown

sp|P31678|OTSB_ECOLI

21

246

S=407 I=41 E=5.49178e-41

Trehalose-phosphate phosphatase EC=3.1.3.12 ; Hydrolase

sp_Pdown

sp|Q9L894|OTSB_SALTY

21

247

S=378 I=40 E=1.76205e-37

Trehalose-phosphate phosphatase EC=3.1.3.12 ; Hydrolase

sp_Pdown

sp|P55611|OTSB_RHISN

21

224

S=336 I=41 E=2.10727e-32

Probable trehalose-phosphate phosphatase EC=3.1.3.12 ; Hydrolase Plasmid

sp_Pdown

sp|O50401|OTSB_MYCTU

21

250

S=185 I=35 E=4.31776e-14

Trehalose-phosphate phosphatase EC=3.1.3.12 ; Hydrolase Magnesium Manganese

sp_Pdown

sp|A5U846|OTSB_MYCTA

21

250

S=185 I=35 E=4.31776e-14

Trehalose-phosphate phosphatase EC=3.1.3.12 ; Hydrolase

Iprscan [G3DSA:3.40.50.1000]

17

246

-

Iprscan [PTHR10788]

19

216

-

Iprscan IPR003337 [PF02358]

21

228

Trehalose-phosphatase

Iprscan IPR003337 [TIGR00685]

19

250

Trehalose-phosphatase

Iprscan IPR006379 [TIGR01484]

19

219

HAD-superfamily hydrolase, subfamily IIB

Iprscan [seg]

2

20

-

PD529241

43

174

S=194 I=40 E=4.23983e-16

PD115059

176

249

S=147 I=46 E=2.31155e-10

Iprscan [SSF56784]

18

249

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one yYN4tSJx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

17 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr14180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr14180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr14180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBV3rHqh/XFF4834R_chr14180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.