Xanthomonas fuscans subsp. fuscans

10 hits

  1. XFF4834R_chr18280XFF4834R_chr19570711_2090547_f1_XFF4834R-XFF4834R_chr18280XFF4834R_chr18280putative outer membrane protein
  2. XFF4834R_chr19090amiCXFF4834R_chr19090putative N-acetylmuramoyl-L-alanine amidase
  3. XFF4834R_chr24170XFF4834R_chr_2786303_2788060_r3_XFF4834R-XFF4834R_chr24170XFF4834R_chr24170putative N-acetylmuramoyl-L-alanine amidase
  4. XFF4834R_chr27260XFF4834R_chr29760196_3142734_r1_XFF4834R-XFF4834R_chr27260XFF4834R_chr27260putative membrane-bound lytic murein transglycosylase D
  5. XFF4834R_chr27830XFF4834R_chr30420042_3212839_r3_XFF4834R-XFF4834R_chr27830XFF4834R_chr27830putative peptidoglycan-specific endopeptidase
  6. XFF4834R_chr31670nagZXFF4834R_chr31670probable beta-N-acetylglucosaminidase
  7. XFF4834R_chr34560sltXFF4834R_chr34560putative soluble lytic murein transglycosylase
  8. XFF4834R_chr37490ampDXFF4834R_chr37490probable N-acetylmuramoyl-L-alanine amidase
  9. XFF4834R_chr41640XFF4834R_chr_4843538_4845694_r3_XFF4834R-XFF4834R_chr41640XFF4834R_chr41640putative lytic murein transglycosylase
  10. XFF4834R_plc00360XFF4834R_plc_0030113_0031384_r1_XFF4834R-XFF4834R_plc00360XFF4834R_plc00360putative lytic murein transglycosylase

XFF4834R_chr19570711_2090547_f1_XFF4834R-XFF4834R_chr18280 XFF4834R_chr18280
XFF4834R_chr18270
XFF4834R_chr18270
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18290
XFF4834R_chr18290
ID XFF4834R_chr19570711_2090547_f1_XFF4834R-XFF4834R_chr18280
AC XFF4834R_chr18280
LT XFF4834R_chr18280
OR XFF4834R_chr from 2089711 to 2090547 on strand +
DE putative outer membrane protein
IP MltA-interacting MipA
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro


Curated
PM
AN This family consists of several bacterial MltA-interacting protein (MipA) like sequences. As well as interacting with the membrane-bound lytic transglycosylase MltA, MipA is known to bind to PBP1B, a bifunctional murein transglycosylase/transpeptidase. MipA is considered to be a structural protein mediating the assembly of MltA to PBP1B into a complex.
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100825)
MW 29929.2 Da
SQ 278 aa
 
........10........20........30........40........50
| | | | |
MNVSSFNRQRATHAVRAGVLACMSALPCIAHAQTDLTGSSRLLGDRTEIT
AGAAAVATPEYAGAERARVQFNPVLVVQRGVLFFDTSRGGGLQFQSKSGF
YISQSLYYDLGRLQSDSNWRPGSRLLAGMGDVPGSVTARTLVMQQVTPYM
NVNAEAEFTLKDAARRNRYRAGMEFTLLHSANDTVTLDLDVHGGDRRFNQ
AYFGVTDAQAARTRFTAFNAGSGAYAAAVGGSWTHSLGDHWATTLGVTGT
RYLDNAEDSPLVARRSVVSGNLALTYSR
XFF4834R

NP_643110.1 lcl|XAC2801-XAC2801

1

278

S=1325 I=91 E=1.62695e-153

hypothetical protein

XFF4834R

YP_364693.1 lcl|ompV-XCV2962

1

278

S=1323 I=91 E=2.47244e-153

outer membrane protein V

XFF4834R

lcl|XALc_1556

14

278

S=684 I=50 E=6.83481e-76

putative outer membrane protein

PDA252X8

1

44

S=203 I=89 E=4.42073e-17

PD662439

140

179

S=200 I=95 E=8.95779e-17

PD449049

45

132

S=146 I=38 E=3.53421e-10

PDA4N957

116

174

S=129 I=46 E=3.88346e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 17tUl3nU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr18280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr18280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr18280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr18280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
amiC XFF4834R_chr19090
XFF4834R_chr19080
XFF4834R_chr19080
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19100
XFF4834R_chr19100
ID amiC
AC XFF4834R_chr19090
LT XFF4834R_chr19090
OR XFF4834R_chr from 2185780 to 2186928 on strand +
DE putative N-acetylmuramoyl-L-alanine amidase
IP Cell wall hydrolase/autolysin, catalytic
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro
Biological Process: peptidoglycan catabolic process (GO:0009253)
Molecular Function: N-acetylmuramoyl-L-alanine amidase activity (GO:0008745)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100509)
MW 40637.7 Da
SQ 382 aa
 
........10........20........30........40........50
| | | | |
MKRRALLQAASAAMALTPGLVRAAGRTRLQACSLQRGDQGTKLRLSLSAP
TQYHMFSLTGPQRLVIDLGQVAPALPPIAAIADGEPVNGIRAGVHGDSVR
VVLDLTRPVAAQPRWQGGELLVDLGGEAAAKTGEAPEVSHVADALGHRLR
PYVVAIDAGHGGKDPGAVSADARYEKHVAMAVAGRLHQRLASDARYRPTM
IRSDDRFVPLHERVLIAHRHNADLFVSIHADAAPTRQARGASVFALSQTG
ASSALARWIADSENAADDMGDTARRLRVPSNPVLSQVLADLSLSGTIASS
LAFGTLMLERLQQVTRLHQNQVGQAGFAVLKSPDIPSLLVETGFMSNRDD
CSRLCSDTHQDELAQTLHAGIDDYFAAFPGRA
XFF4834R

XFF4834R_chr24170 lcl|XFF4834R_chr_2786303_2788060_r3_XFF4834R-XFF4834R_chr24170

137

379

S=423 I=42 E=1.16823e-44

XFF4834R

XFF4834R_chr24170 lcl|XFF4834R_chr_2786303_2788060_r3_XFF4834R-XFF4834R_chr24170

137

379

S=423 I=42 E=1.16823e-44

XFF4834R

NP_642108.1 lcl|amiC-XAC1780

1

382

S=1383 I=73 E=2.01763e-160

N-acetylmuramoyl-L-alanine amidase

XFF4834R

NP_637130.1 lcl|amiC-XCC1763

1

382

S=1348 I=72 E=3.76721e-156

N-acetylmuramoyl-L-alanine amidase

XFF4834R

YP_363543.1 lcl|amiC-XCV1812

1

382

S=1333 I=72 E=2.49648e-154

N-acetylmuramoyl-L-alanine amidase precursor

XFF4834R

lcl|amiC-XALc_1199

18

379

S=1065 I=61 E=7.6165e-122

probable n-acetylmuramoyl-l-alanine amidase precursor protein

XFF4834R

NP_637654.1 lcl|amiC-XCC2299

137

375

S=444 I=43 E=1.36382e-46

N-acetylmuramoyl-L-alanine amidase

XFF4834R

YP_364334.1 lcl|amiC-XCV2603

137

379

S=422 I=42 E=5.78883e-44

N-acetylmuramoyl-L-alanine amidase precursor

XFF4834R

NP_642722.1 lcl|amiC-XAC2406

137

379

S=421 I=42 E=6.95196e-44

N-acetylmuramoyl-L-alanine amidase

XFF4834R

lcl|amiC-XALc_1093

149

379

S=418 I=40 E=1.69173e-43

hypothetical n-acetylmuramoyl-l-alanine amidase protein

pubmed

150

379

S=474 I=48 E=1.03277e-48

Putative acetyl-muramoyl-alanine amidase

Pubmed 15658985

 

prodomImg

pubmed

153

378

S=447 I=43 E=2.31772e-45

Probable N-acetylmuramoyl-L-alanine amidase amiA EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

Pubmed 8300522

 

prodomImg

pubmed

153

379

S=441 I=40 E=1.04743e-44

N-acetylmuramoyl-L-alanine amidase amiB EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

Pubmed 7511774

 

prodomImg

pubmed

153

378

S=440 I=42 E=1.45886e-44

Probable N-acetylmuramoyl-L-alanine amidase amiA EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

Pubmed 8349542

 

prodomImg

pubmed

153

379

S=431 I=41 E=1.53592e-43

N-acetylmuramoyl-L-alanine amidase amiB EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

Pubmed 2676972

 

prodomImg

pubmed

41

375

S=427 I=34 E=4.72964e-43

Putative N-acetylmuramoyl-L-alanine amidase-precursor AmiC

Pubmed 10844690

 

prodomImg

pubmed

41

375

S=423 I=33 E=1.52132e-42

AmiC

Pubmed 10844690

 

prodomImg

pubmed

41

375

S=416 I=34 E=1.21174e-41

N-acetylmuramoyl-L-alanine amidase amiC EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

Pubmed 17038831

 

prodomImg

pubmed

86

379

S=355 I=34 E=3.06214e-34

Predicted N-acetylmuramoyl-L-alanine amidase

Pubmed 10988064

 

prodomImg

pubmed

23

229

S=188 I=30 E=4.907e-14

CwlV

Pubmed 10628856

 

prodomImg

sp_Pdown

sp|P63883|AMIC_ECOLI

148

376

S=511 I=45 E=2.14209e-53

N-acetylmuramoyl-L-alanine amidase amiC EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

sp_Pdown

sp|P63884|AMIC_ECOL6

148

376

S=511 I=45 E=2.14209e-53

N-acetylmuramoyl-L-alanine amidase amiC EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

sp_Pdown

sp|P36548|AMIA_ECOLI

153

378

S=447 I=43 E=1.59581e-45

Probable N-acetylmuramoyl-L-alanine amidase amiA EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

sp_Pdown

sp|P26365|AMIB_ECOLI

153

379

S=441 I=40 E=7.21185e-45

N-acetylmuramoyl-L-alanine amidase amiB EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

sp_Pdown

sp|P33772|AMIA_SALTY

153

378

S=440 I=42 E=1.00446e-44

Probable N-acetylmuramoyl-L-alanine amidase amiA EC=3.5.1.28 ; Cell wall biogenesis/degradation Hydrolase Secreted Signal

PD603210

259

335

S=162 I=49 E=3.89261e-12

PD002984

190

263

S=140 I=46 E=1.933e-09

PDA1L763

152

234

S=112 I=37 E=5.03106e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one sc9OSP8C)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

18 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr19090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr19090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr19090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr19090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_2786303_2788060_r3_XFF4834R-XFF4834R_chr24170 XFF4834R_chr24170
XFF4834R_chr24160
XFF4834R_chr24160
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24180
XFF4834R_chr24180
ID XFF4834R_chr_2786303_2788060_r3_XFF4834R-XFF4834R_chr24170
AC XFF4834R_chr24170
LT XFF4834R_chr24170
OR XFF4834R_chr from 2786303 to 2788036 on strand -
DE putative N-acetylmuramoyl-L-alanine amidase
IP Cell wall hydrolase/autolysin, catalytic; Localisation of periplasmic protein complexes
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro
Biological Process: peptidoglycan catabolic process (GO:0009253)
Molecular Function: N-acetylmuramoyl-L-alanine amidase activity (GO:0008745)

Curated
PM
AN Zn-dependent peptidases AMIN : This N-terminal domain of various bacterial protein families is crucial for the targetting of periplasmic or extracellular proteins to specific regions of the bacterial envelope. AMIN is derived from the N-terminal domain of AmiC, an N-acetylmuramoyl-l-alanine amidase of Escherichia coli which localises to the septal ring during division and plays a key role in the separation of daughter cells. The AMIN domain is present in several protein families besides amidases suggesting that AMIN may represent a general targetting determinant involved in the localisation of periplasmic protein complexes [1].
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100525)
MW 57970 Da
SQ 577 aa
 
........10........20........30........40........50
| | | | |
MLESSAMTPGIRNFCRSALTASLSLAVFAAWGGEIKGVGVSTGATGTRAE
IQLAGSGGFKTLALANPTRLVVDFPESSGVRGLKLPPAAGLVTSVRTGQP
VPGTFRVVFELATPVTPLKPQMQTLGSVSTLVIEWPGDPTPAVASTVAAA
APTAAPAPRPLNAQAEAARATAALAASAQRASSVPPSPPSQPSTPPSAPS
VPASAMPTVTQAPVPTTVATGVPTPRPATSATTGAPAPTGVAGNTNRAAG
AITTVPSGAGGAGSSAAAAAILNGDSAPMGATPGNAAATAPSSASSVAAA
AGDDGLPPRPVLPSEASRIKMAPGMRPLVVAIDPGHGGQDPGAMGPTGKR
EKDVTLAVGRELAHQVNATPGMKAYLTRDTDVFIPLPMRAQKARAAKADI
FISIHADAAENRSATGSSVYVLSTKGASSQRARWLADKENAADLVGGVRL
QQTESTLANVLLDLAQSGHMKASEDAAGHVLGGLKRIGNNHKPQLERANF
AVLRTSDMPAMLVETAFISNPDEERRLIDPAYQRKIASAVLDGIDTFFTR
QPPPGTLFAARAQAEADAVGTVAGGSR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr19090 lcl|amiC-XFF4834R_chr19090

315

552

S=437 I=42 E=3.52288e-46

N-acetylmuramoyl-L-alanine amidase

XFF4834R

NP_637654.1 lcl|amiC-XCC2299

303

577

S=1335 I=92 E=2.34527e-154

N-acetylmuramoyl-L-alanine amidase

XFF4834R

NP_637654.1 lcl|amiC-XCC2299

1

138

S=541 I=81 E=3.4965e-58

N-acetylmuramoyl-L-alanine amidase

XFF4834R

NP_642722.1 lcl|amiC-XAC2406

303

577

S=1316 I=99 E=4.16272e-152

N-acetylmuramoyl-L-alanine amidase

XFF4834R

NP_642722.1 lcl|amiC-XAC2406

1

138

S=684 I=97 E=1.67556e-75

N-acetylmuramoyl-L-alanine amidase

XFF4834R

YP_364334.1 lcl|amiC-XCV2603

246

577

S=1308 I=84 E=4.12314e-151

N-acetylmuramoyl-L-alanine amidase precursor

XFF4834R

YP_364334.1 lcl|amiC-XCV2603

7

138

S=650 I=96 E=1.91996e-71

N-acetylmuramoyl-L-alanine amidase precursor

XFF4834R

lcl|amiC-XALc_1093

309

577

S=1131 I=83 E=1.04795e-129

hypothetical n-acetylmuramoyl-l-alanine amidase protein

XFF4834R

lcl|amiC-XALc_1093

53

138

S=298 I=63 E=9.14095e-29

hypothetical n-acetylmuramoyl-l-alanine amidase protein

XFF4834R

lcl|amiC-XALc_1199

326

552

S=479 I=44 E=1.17816e-50

probable n-acetylmuramoyl-l-alanine amidase precursor protein

XFF4834R

YP_363543.1 lcl|amiC-XCV1812

325

552

S=443 I=43 E=2.78368e-46

N-acetylmuramoyl-L-alanine amidase precursor

XFF4834R

NP_642108.1 lcl|amiC-XAC1780

313

552

S=442 I=42 E=3.81007e-46

N-acetylmuramoyl-L-alanine amidase

XFF4834R

NP_637130.1 lcl|amiC-XCC1763

313

552

S=434 I=41 E=2.85506e-45

N-acetylmuramoyl-L-alanine amidase

Iprscan IPR002508 [G3DSA:3.40.630.40]

327

548

Cell wall hydrolase/autolysin, catalytic

Iprscan IPR002508 [PF01520]

330

545

Cell wall hydrolase/autolysin, catalytic

Iprscan IPR021731 [PF11741]

32

118

Localisation of periplasmic protein complexes

Iprscan IPR002508 [SM00646]

390

545

Cell wall hydrolase/autolysin, catalytic

Iprscan [seg]

139

158

-

Iprscan [seg]

163

243

-

Iprscan [seg]

257

270

-

Iprscan [seg]

277

302

-

Iprscan [SignalP-NN(euk)]

1

29

-

Iprscan [SSF53187]

327

551

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gnnuClPt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

31 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr24170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr24170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr24170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr24170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr29760196_3142734_r1_XFF4834R-XFF4834R_chr27260 XFF4834R_chr27260
XFF4834R_chr27250
XFF4834R_chr27250
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27270
XFF4834R_chr27270
ID XFF4834R_chr29760196_3142734_r1_XFF4834R-XFF4834R_chr27260
AC XFF4834R_chr27260
LT XFF4834R_chr27260
OR XFF4834R_chr from 3141196 to 3142779 on strand -
DE putative membrane-bound lytic murein transglycosylase D
IP Lytic transglycosylase-like, catalytic; Peptidoglycan-binding lysin domain
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro
Biological Process: cell wall macromolecule catabolic process (GO:0016998)

Curated
PM
AN start change
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100619)
MW 57007.2 Da
SQ 527 aa
 
........10........20........30........40........50
| | | | |
MPLAHFGLRPWPVLAVVALMSVVPAAHAVSKRDTEKAAALDARMAAAEKR
YRDALVLVNNSDPKGTAEGDAALEDMEDIIDACIKQRGCLVSNQLATYKR
LLKARADAEAPAAEDPEDDDTLLQADPDHLGPASNGVPEAARAATLLNDQ
RHDFDKMVQYNPAVQAGIRRWLTDMRPALLTSYENYSNLRGVMWPEWQKR
GLPEALLFGIMAKESNGKVHASSRAGAAGLMQFMPATGRRFGLGPDGTGF
DTRFDARSAAEASAAYLNERMAGLNRSIELALAAYNGGEGRAARVFSQSG
GRGFWDQDVYNQFPAETKDYVPMVIAAAWIFLHPRQYGVDFPKLDAQPAT
LKLAKSTTIYELTICLGSMGTRDGYMRALRNLNPRYESDGWIPAGTVINA
TNRIVNLYTRYCVNGPRADLARTLITADLNSAIVRSSSAPEYVPSVAVGD
VSQMAGVPTTVATGQPAVAKPKAKQARSYTIARGDTLGRVAQKYQCEIKE
LAKANGLKAPSYALKPGQSIKLAGCDR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr24420 lcl|XFF4834R_chr26690099_2818082_r2_XFF4834R-XFF4834R_chr24420

201

290

S=123 I=38 E=3.7243e-08

XFF4834R

XFF4834R_chr10670 lcl|mltD-XFF4834R_chr10670

189

347

S=104 I=29 E=7.534e-06

predicted membrane-bound lytic murein transglycosylase D

XFF4834R

YP_364612.1 lcl|XCV2881

1

527

S=2499 I=90 E=0

lytic mureine transglycosylase precursor

XFF4834R

NP_643038.1 lcl|dniR-XAC2729

58

527

S=2276 I=92 E=0

membrane-bound lytic murein transglycosylase D precursor

XFF4834R

NP_637905.1 lcl|dniR-XCC2557

56

527

S=2130 I=85 E=0

membrane-bound lytic murein transglycosylase D precursor

XFF4834R

lcl|XALc_0975

1

527

S=1845 I=66 E=0

putative membrane-bound lytic murein transglycosylase d precursor (murein hydrolase d) protein

XFF4834R

lcl|XALc_1263

185

290

S=133 I=38 E=8.34814e-09

hypothetical soluble lytic murein transglycosylase precursor protein

XFF4834R

YP_364366.1 lcl|XCV2635

201

290

S=123 I=38 E=1.33567e-07

putative soluble lytic murein transglycosylase precursor

XFF4834R

NP_642773.1 lcl|yjbJ-XAC2458

201

290

S=123 I=38 E=1.52228e-07

soluble lytic murein transglycosylase

XFF4834R

NP_637679.1 lcl|yjbJ-XCC2325

201

290

S=121 I=38 E=2.2933e-07

soluble lytic murein transglycosylase

XFF4834R

lcl|mltD-XALc_0595

222

300

S=107 I=35 E=1.34512e-05

probable membrane-bound murein hydrolase d precursor protein

XFF4834R

NP_641425.1 lcl|dniR-XAC1086

189

345

S=106 I=29 E=1.54648e-05

murein hydrolase D

XFF4834R

YP_362817.1 lcl|mltD-XCV1086

189

347

S=105 I=28 E=2.09832e-05

membrane-bound murein hydrolase D

Iprscan [G3DSA:1.10.530.10]

189

351

-

Iprscan [G3DSA:3.10.350.10]

475

525

-

Iprscan [PTHR21666:SF10]

188

293

-

Iprscan [PTHR21666]

188

293

-

Iprscan IPR008258 [PF01464]

198

302

Lytic transglycosylase-like, catalytic

Iprscan IPR018392 [PF01476]

479

522

Peptidoglycan-binding lysin domain

Iprscan IPR002482 [SM00257]

478

523

Peptidoglycan-binding Lysin subgroup

Iprscan [seg]

37

47

-

Iprscan [seg]

106

120

-

Iprscan [seg]

256

265

-

Iprscan [seg]

465

476

-

Iprscan [SignalP-NN(euk)]

1

28

-

Iprscan [SSF53955]

187

353

-

Iprscan [SSF54106]

475

522

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fHqX26k9)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr27260.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr27260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr27260.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr27260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr30420042_3212839_r3_XFF4834R-XFF4834R_chr27830 XFF4834R_chr27830
XFF4834R_chr27820
XFF4834R_chr27820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27840
XFF4834R_chr27840
ID XFF4834R_chr30420042_3212839_r3_XFF4834R-XFF4834R_chr27830
AC XFF4834R_chr27830
LT XFF4834R_chr27830
OR XFF4834R_chr from 3212042 to 3212821 on strand -
DE putative peptidoglycan-specific endopeptidase
IP Peptidase M23B; Peptidase M23; Peptidoglycan-binding lysin domain
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro
Biological Process: cell wall macromolecule catabolic process (GO:0016998)
Biological Process: proteolysis (GO:0006508)
Molecular Function: metalloendopeptidase activity (GO:0004222)

Curated
PM
AN start change
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100622)
MW 26677.2 Da
SQ 259 aa
 
........10........20........30........40........50
| | | | |
MSKTQMNSARKTAVMLAVAIGLTACSSATVVRSPGASGSGSSSRPSAAPR
PSVPRPGATVTVQRGDTLYAISRRTNITAADLAAWNGLSSPNTIYPGQTL
KLYPPGASKPGGSAPVAGGTVAPPRPAVPIAAPVSSGFSWRWPADGVVVG
TFVTGETTKQGVDIAGTSGQAVRAAADGVVVYSGAGLVGYGELIIIKHND
QWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSGAARDMLHFEIRYNGKPV
DPLLYLPKK
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr00250 lcl|envC-XFF4834R_chr00250

160

259

S=186 I=41 E=3.5301e-16

protease with a role in cell division

XFF4834R

XFF4834R_chr07910 lcl|XFF4834R_chr08370943_0914884_f2_XFF4834R-XFF4834R_chr07910

160

256

S=161 I=37 E=4.30317e-13

XFF4834R

XFF4834R_chr37850 lcl|XFF4834R_chr40950456_4376874_f1_XFF4834R-XFF4834R_chr37850

160

253

S=136 I=35 E=4.44474e-10

XFF4834R

XFF4834R_chr23660 lcl|XFF4834R_chr25860280_2737122_f1_XFF4834R-XFF4834R_chr23660

161

258

S=107 I=32 E=1.38928e-06

XFF4834R

NP_642059.1 lcl|nlpD-XAC1728

1

259

S=923 I=71 E=7.1086e-105

lipoprotein

XFF4834R

YP_363492.1 lcl|nlpD-XCV1761

1

259

S=914 I=71 E=8.30956e-104

outer membrane lipoprotein

XFF4834R

NP_637079.1 lcl|nlpD-XCC1709

1

259

S=867 I=68 E=4.29946e-98

lipoprotein

XFF4834R

lcl|XALc_1160

7

259

S=686 I=55 E=3.3358e-76

putative outer membrane lipoprotein precursor

XFF4834R

lcl|XALc_0392

161

259

S=197 I=42 E=6.05345e-17

putative peptidase protein

XFF4834R

NP_635417.1 lcl|XCC0022

160

259

S=188 I=41 E=7.52148e-16

hypothetical protein

XFF4834R

YP_361756.1 lcl|XCV0025

160

259

S=185 I=41 E=1.86251e-15

putative peptidase

XFF4834R

NP_640380.1 lcl|XAC0024-XAC0024

160

259

S=182 I=40 E=3.9422e-15

hypothetical protein

XFF4834R

NP_636124.1 lcl|XCC0733

160

256

S=163 I=37 E=9.49403e-13

peptidase

XFF4834R

NP_641139.1 lcl|XAC0787-XAC0787

160

256

S=161 I=37 E=1.43027e-12

peptidase

XFF4834R

YP_362569.1 lcl|XCV0838

160

256

S=161 I=37 E=1.48103e-12

membrane-bound metalloendopeptidase

XFF4834R

lcl|XALc_2806

160

256

S=149 I=35 E=4.287e-11

putative membrane-bound metalloendopeptidase protein

XFF4834R

YP_365742.1 lcl|XCV4011

160

253

S=136 I=35 E=1.66911e-09

membrane-bound metalloendopeptidase

XFF4834R

NP_644199.1 lcl|XAC3898-XAC3898

160

253

S=136 I=35 E=1.69847e-09

hypothetical protein

XFF4834R

NP_639182.1 lcl|XCC3842

160

253

S=135 I=35 E=1.98708e-09

hypothetical protein

XFF4834R

lcl|XALc_0382

160

252

S=117 I=33 E=3.4359e-07

hypothetical membrane-bound metalloendopeptidase protein

XFF4834R

YP_364291.1 lcl|XCV2560

161

258

S=110 I=32 E=2.50821e-06

metalloendopeptidase precursor

XFF4834R

NP_642677.1 lcl|XAC2361-XAC2361

161

258

S=109 I=32 E=2.83383e-06

peptidase

Iprscan [G3DSA:3.10.350.10]

56

105

-

Iprscan IPR002886 [PTHR21666:SF7]

61

253

Peptidase M23B

Iprscan [PTHR21666]

61

253

-

Iprscan IPR016047 [PF01551]

159

252

Peptidase M23

Iprscan IPR018392 [PF01476]

61

101

Peptidoglycan-binding lysin domain

Iprscan IPR002482 [SM00257]

59

103

Peptidoglycan-binding Lysin subgroup

Iprscan [PS51257]

1

25

-

Iprscan [seg]

30

58

-

Iprscan [seg]

104

119

-

Iprscan [seg]

121

134

-

Iprscan [seg]

146

158

-

Iprscan [SignalP-NN(euk)]

1

27

-

Iprscan [tmhmm]

12

31

-

Iprscan IPR011055 [SSF51261]

56

256

Duplicated hybrid motif

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kNXElg9l)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

78 hits
swiss-prot

Swiss-Prot ncbi-blastp

20 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr27830.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr27830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr27830.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr27830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
nagZ XFF4834R_chr31670
XFF4834R_chr31660
XFF4834R_chr31660
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31680
XFF4834R_chr31680
ID nagZ
AC XFF4834R_chr31670
LT XFF4834R_chr31670
OR XFF4834R_chr from 3635869 to 3636873 on strand -
DE probable beta-N-acetylglucosaminidase
IP Glycoside hydrolase, catalytic core
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN peptidoglycan recycling
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 34954.3 Da
SQ 334 aa
 
........10........20........30........40........50
| | | | |
MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFASRTQVAELSAAIRAA
APRPVLICVDQEGGRVQRFREGFSALAPLQSFGAQYAQDPEAALAAACAH
AQLMASEVRASGVDLSFAPVVDLGRGNRAIGDRAFSDDPQIVATFTRAYV
QALHGAGMAATLKHFPGHGTVLEDTHVDHASDPRPLEVLQAEDLVPFVAG
IEAGADAVMMAHVVYPQVAPEPAGYSQRWIEQILRGQMGFRGVVFSDDIG
MAASFSAGGVAGRVHAHLDAGCDVVLVCQPELVVESLQAVQGRSLNTAAL
IGLIGRGALGWDGLLAGTDASFTTPLSAHFGTTA
XFF4834R

XFF4834R_chr37580 lcl|bglX-XFF4834R_chr37580

107

247

S=133 I=32 E=1.49561e-09

beta-D-glucoside glucohydrolase, periplasmic

XFF4834R

XFF4834R_chr41060 lcl|XFF4834R_chr_4767686_4770391_f2_XFF4834R-XFF4834R_chr41060

117

247

S=95 I=32 E=5.37012e-05

XFF4834R

NP_641669.1 lcl|nagZ-XAC1334

1

334

S=1441 I=89 E=1.57842e-167

beta-hexosaminidase

XFF4834R

YP_363117.1 lcl|XCV1386

1

334

S=1424 I=88 E=1.66042e-165

beta-hexosaminidase

XFF4834R

NP_636657.1 lcl|nagZ-XCC1283

1

334

S=1313 I=82 E=4.80001e-152

beta-hexosaminidase

XFF4834R

lcl|nagZ-XALc_2534

1

323

S=1099 I=73 E=4.61572e-126

probable beta-n-acetylhexosaminidase protein

XFF4834R

YP_365719.1 lcl|bglX-XCV3988

107

247

S=133 I=32 E=5.20558e-09

beta-glucosidase

XFF4834R

NP_644175.1 lcl|bglX-XAC3869

107

247

S=129 I=32 E=1.46914e-08

beta-glucosidase

XFF4834R

lcl|bglX-XALc_0419

107

247

S=123 I=32 E=7.70015e-08

probable beta-glucosidase protein

XFF4834R

NP_639159.1 lcl|bglX-XCC3814

107

247

S=122 I=32 E=1.18042e-07

beta-glucosidase

XFF4834R

NP_636624.1 lcl|bglX-XCC1250

112

247

S=105 I=30 E=1.24174e-05

beta-glucosidase

XFF4834R

NP_644530.1 lcl|XAC4231-XAC4231

117

247

S=104 I=33 E=1.61297e-05

glucan 1,4-beta-glucosidase

XFF4834R

YP_366068.1 lcl|XCV4337

117

247

S=103 I=32 E=2.28606e-05

beta-glucosidase precursor

pubmed

2

279

S=606 I=46 E=1.07753e-64

Beta-hexosaminidase EC=3.2.1.52 ; Cell cycle division shape wall biogenesis/degradation Cytoplasm Glycosidase Hydrolase Peptidoglycan synthesis

Pubmed 8969206

 

prodomImg

pubmed

2

291

S=605 I=45 E=1.42428e-64

Putative beta-hexosaminidase ; Glycosidase Hydrolase

Pubmed 20091296

 

prodomImg

pubmed

6

290

S=552 I=39 E=3.79573e-58

Beta-N-acetylhexosaminidase. Glycosyl Hydrolase family 3 EC=3.2.1.52 Putative N-acetyl-glucosaminidase ; Glycosidase

Pubmed 12754233

 

prodomImg

pubmed

2

279

S=537 I=44 E=2.07635e-56

N-acetylhexosaminidase EC=3.2.1.52 ; Glycosidase Hydrolase

Pubmed 18671744

 

prodomImg

pubmed

2

292

S=432 I=33 E=1.20673e-43

Putative hydrolase ; Glycosidase

Pubmed 14993314

 

prodomImg

sp_Pdown

sp|Q8PMU1|NAGZ_XANAC

1

334

S=1441 I=89 E=4.48726e-166

Beta-hexosaminidase EC=3.2.1.52 ; Cell cycle division shape wall biogenesis/degradation Cytoplasm Glycosidase Hydrolase Peptidoglycan synthesis

sp_Pdown

sp|Q3BVU6|NAGZ_XANC5

1

334

S=1425 I=88 E=4.40233e-164

Beta-hexosaminidase EC=3.2.1.52 ; Cell cycle division shape wall biogenesis/degradation Cytoplasm Glycosidase Hydrolase Peptidoglycan synthesis

sp_Pdown

sp|Q5H1Q0|NAGZ_XANOR

1

334

S=1417 I=87 E=3.29887e-163

Beta-hexosaminidase EC=3.2.1.52 ; Cell cycle division shape wall biogenesis/degradation Cytoplasm Glycosidase Hydrolase Peptidoglycan synthesis

sp_Pdown

sp|Q2P4L0|NAGZ_XANOM

1

334

S=1410 I=87 E=2.30545e-162

Beta-hexosaminidase EC=3.2.1.52 ; Cell cycle division shape wall biogenesis/degradation Cytoplasm Glycosidase Hydrolase Peptidoglycan synthesis

sp_Pdown

sp|Q8PB42|NAGZ_XANCP

1

334

S=1313 I=82 E=1.36458e-150

Beta-hexosaminidase EC=3.2.1.52 ; Cell cycle division shape wall biogenesis/degradation Cytoplasm Glycosidase Hydrolase Peptidoglycan synthesis

Iprscan IPR001764 [G3DSA:3.20.20.300]

1

278

Glycoside hydrolase, family 3, N-terminal

Iprscan [MF_00364]

1

334

-

Iprscan IPR001764 [PF00933]

54

276

Glycoside hydrolase, family 3, N-terminal

Iprscan IPR019800 [PS00775]

233

250

Glycoside hydrolase, family 3, active site

Iprscan [seg]

84

105

-

Iprscan [seg]

298

310

-

PD891609

109

291

S=231 I=31 E=1.61793e-20

PD001132

33

276

S=203 I=33 E=4.32262e-17

PD232689

209

253

S=138 I=50 E=3.67019e-09

PD397290

106

150

S=117 I=47 E=1.07079e-06

PD880206

153

210

S=116 I=48 E=1.42777e-06

PDA4K4A3

2

70

S=105 I=41 E=3.26598e-05

PD928527

1

25

S=104 I=88 E=4.02614e-05

PDA8V938

206

279

S=103 I=36 E=5.96049e-05

Iprscan IPR017853 [SSF51445]

1

278

Glycoside hydrolase, catalytic core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zGXzH6il)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

135 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr31670.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr31670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr31670.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr31670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
slt XFF4834R_chr34560
XFF4834R_chr34550
XFF4834R_chr34550
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34570
XFF4834R_chr34570
ID slt
AC XFF4834R_chr34560
LT XFF4834R_chr34560
OR XFF4834R_chr from 4009150 to 4011123 on strand +
DE putative soluble lytic murein transglycosylase
IP Lytic transglycosylase-like, catalytic; Lytic transglycosylase, superhelical U-shaped and linker domain
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro
Cellular Component: periplasmic space (GO:0042597)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN Also CL 1.2.3 Proteins/peptides/glycopeptides (CL 1.6.7 Peptidoglycan (murein) is for biosynthesis)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100811)
MW 72142.7 Da
SQ 657 aa
 
........10........20........30........40........50
| | | | |
MTYAPRLATVFIGLLCLGSTALHAQTLDPQLTAMRDAIAAAERGQTDAGQ
LAALSRHPLYGWLEFAALKRTIDTVSNAQAQAFLQRYAGQPVAESFRSTW
LPAVARRQDWNTLLANWKSTDNLGLRCAQLTARLATGKADAQWSRDALTL
WRNGKALPDACDAVVAGLESRGELTPALRWERVDAAADAQQPAVMRTAAR
GLPAADLALATDYAAFLDKVHPRALGWPKTERSRRIAVDGLSKLAKSDPD
AAEQQLPQLASALGFSEAQRGQVLYQIALWTVASYLPDSARRLNAVPDAS
YDERLHEWRAREAMSRGDWPAALAAIRKMPASQRSDSRWQYFEARLAEKT
GAAAAAQPLYRAAAQSPTFHGFLAADRLQQPYRLCPWEPNDSAQAKAAVA
RDPALVRAIALFQIDRPGWAVAEWNDAATRFDDTQRRLAVEVASDNGWFD
RAVFALGKQPDEQRLYALRFPLHHDDTIRREAAKNAIDPAWVAGEIRAES
IFNPRARSPANAMGLMQVLPGTGAAVAKGIALPGYAGASSLYEPDTNIAI
GTAYLRQLLNTYGLPYLTIAAYNAGPGPTGRWQSQRPNFEPDFWIETISY
KETREYVARVLAFSVIYDWRLNGDMLPLSDRLMGKLVDKRLKPVCTPGQA
ANNAAQD
XFF4834R

XFF4834R_chr24420 lcl|XFF4834R_chr26690099_2818082_r2_XFF4834R-XFF4834R_chr24420

449

598

S=126 I=31 E=2.1353e-08

XFF4834R

NP_643868.1 lcl|slt-XAC3561

1

657

S=3140 I=92 E=0

soluble lytic murein transglycosylase

XFF4834R

YP_365417.1 lcl|slt-XCV3686

1

657

S=3127 I=92 E=0

soluble lytic murein transglycosylase precursor

XFF4834R

NP_638752.1 lcl|slt-XCC3406

1

657

S=2935 I=86 E=0

soluble lytic murein transglycosylase

XFF4834R

lcl|slt-XALc_0843

18

645

S=2264 I=69 E=0

probable soluble lytic murein transglycosylase precursor protein

XFF4834R

NP_642773.1 lcl|yjbJ-XAC2458

449

598

S=124 I=32 E=1.20972e-07

soluble lytic murein transglycosylase

XFF4834R

YP_364366.1 lcl|XCV2635

449

598

S=124 I=32 E=1.31993e-07

putative soluble lytic murein transglycosylase precursor

XFF4834R

NP_637679.1 lcl|yjbJ-XCC2325

449

598

S=120 I=31 E=3.82389e-07

soluble lytic murein transglycosylase

XFF4834R

lcl|XALc_1263

474

598

S=109 I=32 E=9.13677e-06

hypothetical soluble lytic murein transglycosylase precursor protein

XFF4834R

lcl|XALr_3249

463

594

S=106 I=31 E=2.32246e-05

probable lytic transglycosylase protein

pubmed

7

630

S=559 I=30 E=1.01522e-58

Putative soluble lytic transglycosylase

Pubmed 20091296

 

prodomImg

pubmed

6

624

S=478 I=27 E=6.86002e-49

Soluble lytic murein transglycosylase EC=4.2.2.n1 ; Cell wall biogenesis/degradation Disulfide bond Lyase Periplasm Signal

Pubmed 1938883

 

prodomImg

pubmed

18

632

S=447 I=28 E=4.90894e-45

Soluble lytic murein transglycosylase

Pubmed 15305924

 

prodomImg

pubmed

482

613

S=156 I=36 E=6.87586e-10

Membrane-bound lytic murein transglycosylase C EC=3.2.1.- ; Glycosidase Hydrolase

Pubmed 18459973

 

prodomImg

pubmed

487

581

S=155 I=37 E=1.00034e-09

Putative lytic transglycosylase ; Signal

Pubmed 12820036

 

prodomImg

sp_Pdown

sp|P0AGC3|SLT_ECOLI

6

624

S=478 I=27 E=4.67039e-49

Soluble lytic murein transglycosylase EC=4.2.2.n1 ; Cell wall biogenesis/degradation Disulfide bond Lyase Periplasm Signal

sp_Pdown

sp|P0AGC4|SLT_ECO57

6

624

S=478 I=27 E=4.67039e-49

Soluble lytic murein transglycosylase EC=4.2.2.n1 ; Cell wall biogenesis/degradation Disulfide bond Lyase Periplasm Signal

sp_Pdown

sp|P39434|SLT_SALTY

6

617

S=465 I=28 E=1.71072e-47

Soluble lytic murein transglycosylase EC=4.2.2.n1 ; Cell wall biogenesis/degradation Disulfide bond Lyase Periplasm Signal

sp_Pdown

sp|P44888|SLT_HAEIN

329

617

S=260 I=30 E=1.40729e-22

Putative soluble lytic murein transglycosylase EC=4.2.2.n1 ; Cell wall biogenesis/degradation Lyase Periplasm Signal

sp_Pdown

sp|O31608|YJBJ_BACSU

475

599

S=176 I=36 E=1.91016e-12

Putative murein lytic transglycosylase yjbJ EC=4.-.-.- ; Lyase

Iprscan IPR008939 [G3DSA:1.25.20.10]

25

381

Lytic transglycosylase, superhelical U-shaped

Iprscan [G3DSA:1.10.530.10]

467

637

-

Iprscan [PTHR21666:SF10]

462

580

-

Iprscan [PTHR21666]

462

580

-

Iprscan IPR008258 [PF01464]

478

589

Lytic transglycosylase-like, catalytic

Iprscan [seg]

183

194

-

Iprscan [seg]

204

218

-

Iprscan [seg]

352

364

-

Iprscan [SignalP-NN(euk)]

1

24

-

Iprscan [tmhmm]

7

24

-

PD042587

35

471

S=531 I=34 E=9.12206e-57

PD612032

1

51

S=256 I=98 E=2.17839e-23

PDA1S681

618

657

S=211 I=100 E=5.32514e-18

PD883389

24

145

S=133 I=32 E=1.76037e-08

PDA1S679

472

498

S=130 I=93 E=3.72601e-08

PD580287

499

584

S=118 I=38 E=1.21856e-06

PD695641

240

345

S=116 I=33 E=2.09223e-06

PDA3A7A9

51

136

S=112 I=28 E=5.85352e-06

PD269290

486

522

S=104 I=57 E=5.4546e-05

PDA3Y1C7

582

634

S=104 I=36 E=5.50236e-05

Iprscan IPR016026 [SSF48435]

25

471

Lytic transglycosylase, superhelical U-shaped and linker domain

Iprscan [SSF53955]

472

637

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one H4bhqaFF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

75 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr34560.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr34560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr34560.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQ7OTZN/XFF4834R_chr34560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ampD XFF4834R_chr37490
XFF4834R_chr_4592
XFF4834R_chr_4592
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37500
XFF4834R_chr37500
ID ampD
AC XFF4834R_chr37490
LT XFF4834R_chr37490
OR XFF4834R_chr from 4334444 to 4335250 on strand -
DE probable N-acetylmuramoyl-L-alanine amidase
IP N-acetylmuramoyl-L-alanine amidase, family 2
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro
Biological Process: peptidoglycan catabolic process (GO:0009253)
Molecular Function: N-acetylmuramoyl-L-alanine amidase activity (GO:0008745)

Curated
PM
AN
CC COG: [V] Defense mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100712)
MW 29157.2 Da
SQ 268 aa
 
........10........20........30........40........50
| | | | |
MLPSFSLSSSAWLRTAVCLAALSLGACAHAPQRNPLAQWVPSPNYDTRRP
ILIVLHFTDQHSVRQSLSTLRGRNSGGRVSAHYLIGEDGQRYQLVSDGLR
AWHGGAGRWGTITDINSASIGIELDNDGSEPFAPAQIDSLLVLLDDLCQR
LRIPRTQIVGHEDVAPTRKNDPGPLFPWRRLADAGFGRWPAADAPAAPEG
FDPWQALALIGYSIDDPAATLQAFHHHYRGNSATTLDAEDLRILSAMTNH
ARLSGSRPALEPTEGDDH
XFF4834R

YP_365709.1 lcl|ampD-XCV3978

1

268

S=1240 I=93 E=3.10745e-143

N-acetylmuramoyl-L-alanine amidase

XFF4834R

NP_644166.1 lcl|XAC3860-XAC3860

1

267

S=1205 I=91 E=5.22569e-139

N-acetylmuramoyl-L-alanine amidase

XFF4834R

NP_639150.1 lcl|XCC3805

12

248

S=958 I=84 E=4.02742e-109

N-acetylmuramoyl-L-alanine amidase

XFF4834R

lcl|ampD-XALc_0423

25

249

S=817 I=73 E=4.72707e-92

probable n-acetylmuramoyl-l-alanine amidase precursor protein

pubmed

40

250

S=226 I=33 E=8.32348e-19

BimB N-acetylmuramoyl-L-alanine amidase domain protein

Pubmed 16267310

 

prodomImg

pubmed

78

187

S=201 I=41 E=9.71346e-16

N-acetylmuramyl-L-alanine amidase

Pubmed 9390420

 

prodomImg

pubmed

75

195

S=180 I=40 E=3.01227e-13

N-acetyl-anhydromuramyl-L-alanine amidase

Pubmed 14766547

 

prodomImg

pubmed

78

181

S=175 I=38 E=1.20489e-12

N-acetyl-anhydromuramyl-L-alanine amidase variant 3

Pubmed 11557489

 

prodomImg

pubmed

78

181

S=175 I=38 E=1.36132e-12

N-acetyl-anhydromuramyl-L-alanine amidase

Pubmed 1