Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr23020cmkXFF4834R_chr23020probable cytidylate kinase
  2. XFF4834R_chr25320uppXFF4834R_chr25320probable uracil phosphoribosyltransferase

cmk XFF4834R_chr23020
XFF4834R_chr23010
XFF4834R_chr23010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23030
XFF4834R_chr23030
ID cmk
AC XFF4834R_chr23020
LT XFF4834R_chr23020
OR XFF4834R_chr from 2667259 to 2667942 on strand -
DE probable cytidylate kinase
IP Cytidylate kinase; Cytidylate kinase region
CL 1.7.33.4 Salvage pathways of pyrimidine ribonucleotides
EC
GO InterPro
Molecular Function: cytidylate kinase activity (GO:0004127)
Molecular Function: ATP binding (GO:0005524)
nucleotide and nucleic acid metabolic process (GO:0006139)

Curated
PM
AN gene localise dans l operon rpsA
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100906)
MW 24155.2 Da
SQ 227 aa
 
........10........20........30........40........50
| | | | |
MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWA
DLDVSDPAALVRCTFDTKVEFDDAGEAGLRVLVNGVDATGELRLETTGAL
ASAIAAIPEVRSALKERQRAFRRAPGLVADGRDMGTVIFPDAAFKVFLTA
SAEERAGRRHKQLMEKGVSVIFDDLLREIMARDARDAQRVVAPLRPAEDA
VLIDTSGMGIEDVVQRVVGLLADRTPS
XFF4834R

NP_642616.1 lcl|cmk-XAC2299

1

227

S=1055 I=93 E=5.13963e-121

cytidylate kinase

XFF4834R

YP_364228.1 lcl|cmk-XCV2497

1

226

S=1051 I=92 E=2.00275e-120

cytidylate kinase

XFF4834R

NP_637551.1 lcl|cmk-XCC2195

1

226

S=1030 I=91 E=5.64281e-118

cytidylate kinase

XFF4834R

lcl|cmk-XALc_1603

1

221

S=866 I=78 E=4.27216e-98

probable cytidylate kinase protein

pubmed

1

219

S=513 I=48 E=9.94715e-54

Cytidylate kinase ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 17400574

 

prodomImg

pubmed

1

218

S=512 I=49 E=1.15364e-53

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 6384724

 

prodomImg

pubmed

8

222

S=384 I=36 E=4.51749e-38

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 10217496

 

prodomImg

pubmed

8

218

S=379 I=37 E=1.90401e-37

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 7704259

 

prodomImg

pubmed

8

224

S=373 I=37 E=8.30978e-37

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 19014707

 

prodomImg

pubmed

8

225

S=373 I=37 E=8.45595e-37

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 19124572

 

prodomImg

pubmed

8

224

S=340 I=35 E=8.95813e-33

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 18281406

 

prodomImg

pubmed

8

223

S=339 I=33 E=1.03893e-32

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 17592475

 

prodomImg

pubmed

8

225

S=332 I=30 E=8.71957e-32

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 18359806

 

prodomImg

pubmed

8

224

S=329 I=36 E=2.08519e-31

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 10484179

 

prodomImg

sp_Pdown

sp|Q8PK76|KCY_XANAC

1

227

S=1055 I=93 E=1.26932e-119

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q3BSN5|KCY_XANC5

1

226

S=1051 I=92 E=4.94612e-119

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|B0RSA3|KCY_XANCB

1

226

S=1041 I=92 E=8.05278e-118

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q5H0T8|KCY_XANOR

1

227

S=1033 I=91 E=7.12151e-117

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|B2SLH6|KCY_XANOP

1

227

S=1033 I=91 E=7.12151e-117

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

PD005731

108

211

S=297 I=57 E=1.7451e-28

PD600108

55

98

S=195 I=89 E=4.27824e-16

PD709777

7

46

S=170 I=78 E=4.57582e-13

PDA4V051

193

227

S=155 I=89 E=3.00602e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one tPrVyB4D)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

449 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNdBidd/XFF4834R_chr23020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNdBidd/XFF4834R_chr23020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNdBidd/XFF4834R_chr23020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNdBidd/XFF4834R_chr23020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
upp XFF4834R_chr25320
XFF4834R_chr25310
XFF4834R_chr25310
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25330
XFF4834R_chr25330
ID upp
AC XFF4834R_chr25320
LT XFF4834R_chr25320
OR XFF4834R_chr from 2922523 to 2923155 on strand +
DE probable uracil phosphoribosyltransferase
IP Uracil phosphoribosyl transferase
CL 1.7.33.4 Salvage pathways of pyrimidine ribonucleotides
EC
GO InterPro
Biological Process: nucleoside metabolic process (GO:0009116)
Biological Process: uracil salvage (GO:0006223)
Molecular Function: uracil phosphoribosyltransferase activity (GO:0004845)

Curated
PM
AN ai change le start enleve 41 aa, hamap upp disparu apres le changement de start
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: acur
CC STATUS: curated by brin (20100906)
MW 22607.1 Da
SQ 210 aa
 
........10........20........30........40........50
| | | | |
MKIVEVRHPLVQHKIGLLRDAALSTKGFRELVTELGTLLAYEATANLDTE
SHTQPGWAGPVTVQRIAGAKITLVPILRAGLGMLPGVLALIPAARVSVVG
LQRDEETLQPVPYFERLTGRLEERDALILDPMLATGGTLIATIDMLKRAG
ARRIKGIFLVAAPEGLKALEAVHPDVEVYTAAIDDHLNDKGYILPGLGDA
GDRIFGTRLE
XFF4834R

YP_364434.1 upp-XCV2703

1

210

S=1060 I=100 E=1.44531e-121

uracil phosphoribosyltransferase

XFF4834R

NP_642836.1 upp-XAC2521

1

210

S=1058 I=100 E=2.29428e-121

uracil phosphoribosyltransferase

XFF4834R

NP_637740.1 upp-XCC2386

1

210

S=1044 I=98 E=1.04505e-119

uracil phosphoribosyltransferase

pubmed

1

208

S=746 I=66 E=5.62087e-82

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 1371255

 

prodomImg

pubmed

1

208

S=714 I=65 E=3.62266e-78

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 19675025

 

prodomImg

pubmed

8

208

S=698 I=64 E=3.25735e-76

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 19187283

 

prodomImg

pubmed

6

208

S=580 I=55 E=6.81437e-62

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 7961396

 

prodomImg

pubmed

2

208

S=562 I=53 E=1.12802e-59

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 9268683,12037295

 

prodomImg

sp_Pdown

sp|Q3BS29|UPP_XANC5

1

210

S=1060 I=100 E=3.88197e-120

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

sp_Pdown

sp|P59001|UPP_XANAC

1

210

S=1058 I=100 E=6.16222e-120

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

sp_Pdown

sp|Q9RBJ3|UPP_XANCP

1

210

S=1044 I=98 E=2.8069e-118

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

sp_Pdown

sp|B0RRQ3|UPP_XANCB

1

210

S=1044 I=98 E=2.8069e-118

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

sp_Pdown

sp|Q4UVY0|UPP_XANC8

1

210

S=1044 I=98 E=2.8069e-118

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Iprscan [G3DSA:3.40.50.2020]

6

208

-

Iprscan [PTHR10285:SF1]

1

207

-

Iprscan [PTHR10285]

1

207

-

Iprscan IPR000836 [PF00156]

64

159

Phosphoribosyltransferase

Iprscan IPR005765 [TIGR01091]

2

208

Uracil phosphoribosyl transferase

PD847129

66

138

S=224 I=64 E=1.1421e-19

PD580329

166

208

S=169 I=67 E=5.00305e-13

PD003612

2

48

S=153 I=64 E=4.61775e-11

PDA1V3Z2

139

165

S=130 I=100 E=3.22178e-08

PDA082Z8

116

184

S=117 I=35 E=9.65679e-07

PDA816W0

139

169

S=107 I=65 E=1.67117e-05

Iprscan [SSF53271]

3

208

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hNts2SZM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

52 hits
swiss-prot

Swiss-Prot ncbi-blastp

515 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNdBidd/XFF4834R_chr25320.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNdBidd/XFF4834R_chr25320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNdBidd/XFF4834R_chr25320.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNdBidd/XFF4834R_chr25320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.