Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr41480tdkXFF4834R_chr41480probable thymidine kinase/deoxyuridine kinase

tdk XFF4834R_chr41480
XFF4834R_chr_4432
XFF4834R_chr_4432
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr41490
XFF4834R_chr41490
ID tdk
AC XFF4834R_chr41480
LT XFF4834R_chr41480
OR XFF4834R_chr from 4825140 to 4825769 on strand +
DE probable thymidine kinase/deoxyuridine kinase
IP Thymidine kinase
CL 1.7.33.3 Salvage pathways of pyrimidine deoxyribonucleotides
EC
GO InterPro
Molecular Function: thymidine kinase activity (GO:0004797)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN signal peptide?
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 23479.7 Da
SQ 209 aa
 
........10........20........30........40........50
| | | | |
MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRAGSGVVA
SRIGLRADGRIFERDTELQQLVERDIHNDGALHCVLVDEAQFLSRAQVWQ
LSEVVDRLRIPVLCYGLRTDFRGELFEGSQFLLAWADELEEIKTICHSGS
KATMTVRVDAHGHAVQDGPQVEIGGNERYVSVSRAEFKKIMRGEGRIDPL
QIALPLPVA
Show or not Domain decomposition
 
XFF4834R

NP_644581.1 lcl|tdk-XAC4282

1

209

S=1111 I=100 E=7.36836e-128

thymidine kinase

XFF4834R

YP_366115.1 lcl|tdk-XCV4384

1

209

S=1106 I=100 E=3.21581e-127

thymidine kinase

XFF4834R

NP_639482.1 lcl|tdk-XCC4143

1

209

S=1029 I=93 E=7.11844e-118

thymidine kinase

XFF4834R

lcl|tdk-XALc_3163

1

203

S=970 I=89 E=1.02066e-110

probable thymidine kinase protein

Iprscan IPR001267 [PIRSF035805]

1

201

Thymidine kinase

Iprscan IPR001267 [PTHR11441]

1

192

Thymidine kinase

Iprscan IPR001267 [PF00265]

3

185

Thymidine kinase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one G8yVQ4nl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

32 hits
swiss-prot

Swiss-Prot ncbi-blastp

158 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_GlrKH/XFF4834R_chr41480.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_GlrKH/XFF4834R_chr41480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_GlrKH/XFF4834R_chr41480.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_GlrKH/XFF4834R_chr41480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.