Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr31650deoDXFF4834R_chr31650probable purine nucleoside phosphorylase II
  2. XFF4834R_chr31660hptXFF4834R_chr31660probable hypoxanthine phosphoribosyltransferase

deoD XFF4834R_chr31650
XFF4834R_chr31640
XFF4834R_chr31640
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31660
XFF4834R_chr31660
ID deoD
AC XFF4834R_chr31650
LT XFF4834R_chr31650
OR XFF4834R_chr from 3634480 to 3635232 on strand -
DE probable purine nucleoside phosphorylase II
IP Nucleoside phosphorylase; Purine phosphorylase, family 2, conserved site
CL 1.7.33.2 Salvage pathways of guanine, xanthine, and their nucleosides
EC
GO InterPro
Biological Process: nucleoside metabolic process (GO:0009116)
Molecular Function: catalytic activity (GO:0003824)
transferring pentosyl groups (GO:0016763)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 26194.7 Da
SQ 250 aa
 
........10........20........30........40........50
| | | | |
MSANSIALAVIGGTGVYKLAQLDDVQSHDIQTPYGAPSGPIRVGMLLGHR
VAFLARHGEGHSLPPHKVNYRANIAALQQIGASRVLALNTVGGITEQFGP
RVLACPDQLIDYTWGRVSTFCEEPGSEVQHVDFGHPYSPMFRSKVIAAAK
VTGVTLVAGGCYGATQGPRLETVAEIARMRRDGCDLVGMTGMPEAGLARE
KGLEYACLAIVANWAAGCGDAQEITMAEVLANVDAASSGLPELIGELARG
Show or not Domain decomposition
 
XFF4834R

NP_641671.1 lcl|deoD-XAC1336

1

250

S=1303 I=99 E=5.69916e-151

5'-methylthioadenosine phosphorylase

XFF4834R

YP_363119.1 lcl|deoD-XCV1388

1

250

S=1301 I=99 E=9.70036e-151

5'-methylthioadenosine phosphorylase

XFF4834R

NP_636659.1 lcl|deoD-XCC1285

1

250

S=1264 I=94 E=3.483e-146

5'-methylthioadenosine phosphorylase

XFF4834R

lcl|XALc_2532

4

250

S=1116 I=83 E=2.8076e-128

putative purine-nucleoside phosphorylase protein

pubmed

8

240

S=410 I=42 E=3.73852e-41

5'-fluoro-5'-deoxy-adenosine phosphorylase

Pubmed 16720268

 

prodomImg

pubmed

6

214

S=385 I=39 E=3.30066e-38

Putative 5'-methylthioadenosine phosphorylase

Pubmed 14617179

 

prodomImg

pubmed

29

232

S=335 I=41 E=4.15585e-32

Probable 5'-methylthioadenosine phosphorylase

Pubmed 16581904

 

prodomImg

pubmed

2

244

S=313 I=30 E=2.06372e-29

S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Cytoplasm Glycosyltransferase Phosphoprotein Polymorphism

Pubmed 7604019,8650244

 

prodomImg

pubmed

2

214

S=310 I=33 E=4.64298e-29

S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Cytoplasm Glycosyltransferase Phosphoprotein

Pubmed 12824877

 

prodomImg

pubmed

5

233

S=305 I=32 E=1.67268e-28

Multicopy enhancer of UAS2 ; Glycosyltransferase

Pubmed 8807288

 

prodomImg

pubmed

5

233

S=305 I=32 E=1.95691e-28

YLR017W

Pubmed 17322287

 

prodomImg

pubmed

26

131

S=262 I=52 E=2.57587e-23

Nucleoside phosphorylase

Pubmed 15607633

 

prodomImg

pubmed

26

131

S=262 I=52 E=2.66729e-23

Nucleoside phosphorylase

Pubmed 15607633

 

prodomImg

pubmed

30

210

S=255 I=35 E=2.05169e-22

Methylthioadenosine phosphorylase MTAP

Pubmed 16373569

 

prodomImg

sp_Pdown

sp|Q87BR7|MTNP_XYLFT

4

249

S=1017 I=76 E=7.549e-115

Probable S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Amino-acid biosynthesis Glycosyltransferase Methionine

sp_Pdown

sp|Q9PAZ2|MTNP_XYLFA

4

233

S=986 I=78 E=3.55467e-111

Probable S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Amino-acid biosynthesis Glycosyltransferase Methionine

sp_Pdown

sp|Q87ZC3|MTNP_PSESM

9

229

S=606 I=57 E=3.79799e-65

Probable S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Amino-acid biosynthesis Glycosyltransferase Methionine

sp_Pdown

sp|Q9HZK1|MTNP_PSEAE

9

229

S=582 I=55 E=3.82167e-62

Probable S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Amino-acid biosynthesis Glycosyltransferase Methionine

sp_Pdown

sp|O57865|Y125_PYRHO

8

224

S=435 I=42 E=1.9748e-44

Uncharacterized protein PH0125 ; Glycosyltransferase

PDA1V4L2

218

250

S=162 I=100 E=3.63323e-12

PD005375

6

61

S=160 I=52 E=6.86607e-12

PDA2M418

8

110

S=149 I=32 E=1.36609e-10

PD003195

136

228

S=143 I=39 E=7.09788e-10

PDA42944

58

120

S=114 I=41 E=2.66434e-06

PDA1F870

63

94

S=109 I=56 E=1.06572e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one IlsuNUjV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEXKyem/XFF4834R_chr31650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEXKyem/XFF4834R_chr31650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEXKyem/XFF4834R_chr31650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEXKyem/XFF4834R_chr31650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
hpt XFF4834R_chr31660
XFF4834R_chr31650
XFF4834R_chr31650
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31670
XFF4834R_chr31670
ID hpt
AC XFF4834R_chr31660
LT XFF4834R_chr31660
OR XFF4834R_chr from 3635315 to 3635869 on strand -
DE probable hypoxanthine phosphoribosyltransferase
IP Phosphoribosyltransferase
CL 1.7.33.2 Salvage pathways of guanine, xanthine, and their nucleosides
EC
GO InterPro
Biological Process: nucleoside metabolic process (GO:0009116)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 20176.9 Da
SQ 184 aa
 
........10........20........30........40........50
| | | | |
MSTLTISQALAQADLLVDRPAIDAAVATIADAIARDYAGEVPVYLTIMHG
ALPFSGQLALELGARGQDLQFDYLHATRYRGETTGGELVWKHRPATALFG
RRVILVDDILDEGYTLQGVRQWCLEQGATDVRVAVLTVKRHDRCVPGVTA
DYVGVEVPDRYVFGFGMDVNEQLRGIPAIYAMKQ
XFF4834R

YP_363118.1 hpt-XCV1387

1

184

S=869 I=91 E=1.63193e-98

hypoxanthine-guanine phosphoribosyltransferase

XFF4834R

NP_641670.1 hpt-XAC1335

1

184

S=869 I=91 E=1.63193e-98

hypoxanthine-guanine phosphoribosyltransferase

XFF4834R

NP_636658.1 hpt-XCC1284

1

184

S=862 I=91 E=1.00068e-97

hypoxanthine-guanine phosphoribosyltransferase

XFF4834R

XALc_2533 XALc_2533

1

184

S=742 I=76 E=3.85399e-83

putative phosphoribosyltransferase protein

pubmed

37

183

S=198 I=32 E=1.08277e-15

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Pubmed 1465108

 

prodomImg

pubmed

43

179

S=173 I=25 E=1.28582e-12

Hypoxanthine-guanine phosphoribosyltransferase ; Glycosyltransferase

Pubmed 16113341

 

prodomImg

pubmed

43

184

S=170 I=30 E=3.0482e-12

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Pubmed 15113653

 

prodomImg

pubmed

37

184

S=168 I=28 E=4.79669e-12

Hypoxanthine-guanine-xanthine phosphoribosyltransferase EC=2.4.2.- ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Pubmed 8008020,8679528

 

prodomImg

pubmed

43

184

S=167 I=30 E=6.62281e-12

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Pubmed 1783384,1781355

 

prodomImg

sp_Pdown

sp|Q8DRP8|HPRT_STRR6

37

184

S=217 I=32 E=3.3948e-18

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

sp_Pdown

sp|Q97TC4|HPRT_STRPN

37

184

S=217 I=32 E=3.3948e-18

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

sp_Pdown

sp|Q5M6K8|HPRT_STRT2

37

184

S=210 I=32 E=2.75154e-17

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

sp_Pdown

sp|Q5M216|HPRT_STRT1

37

184

S=210 I=32 E=2.75154e-17

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

sp_Pdown

sp|Q8E2H3|HPRT_STRA5

37

184

S=207 I=32 E=5.43155e-17

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Iprscan [G3DSA:3.40.50.2020]

14

184

-

Iprscan [PTHR22573:SF9]

22

184

-

Iprscan [PTHR22573]

22

184

-

Iprscan IPR000836 [PF00156]

16

136

Phosphoribosyltransferase

Iprscan [seg]

21

36

-

PDA1M1A2

1

68

S=235 I=72 E=4.75467e-21

PD622421

69

101

S=140 I=82 E=1.58291e-09

PDA4X532

98

181

S=127 I=36 E=6.96303e-08

Iprscan [SSF53271]

9

184

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pQDbTpip)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

50 hits
swiss-prot

Swiss-Prot ncbi-blastp

60 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEXKyem/XFF4834R_chr31660.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEXKyem/XFF4834R_chr31660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEXKyem/XFF4834R_chr31660.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEXKyem/XFF4834R_chr31660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.