Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr24020aptXFF4834R_chr24020probable adenine phosphoribosyltransferase

apt XFF4834R_chr24020
XFF4834R_chr24010
XFF4834R_chr24010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24030
XFF4834R_chr24030
ID apt
AC XFF4834R_chr24020
LT XFF4834R_chr24020
OR XFF4834R_chr from 2769399 to 2769959 on strand -
DE probable adenine phosphoribosyltransferase
IP Phosphoribosyltransferase
CL 1.7.33.1 Salvage pathways of adenine, hypoxanthine, and their nucleosides
EC
GO InterPro
Biological Process: nucleoside metabolic process (GO:0009116)
Biological Process: adenine salvage (GO:0006168)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: adenine phosphoribosyltransferase activity (GO:0003999)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100906)
MW 20149.9 Da
SQ 186 aa
 
........10........20........30........40........50
| | | | |
MTDCSRCAGTNTSGPNHWSERIRDIVDFPKPGIVFKDITPLLSDGPDFAS
ALDEMAQPWRTTPLDAVLGIEARGFILGAALARELRTGFVPVRKPGKLPG
RTLIQEYALEYGTDRIEMHEDALPRGARVLIVDDVLATGGTLRAALGLAA
QLEFEVVGAAVLVELQGLQGRQKWVNDVPLLATLSY
XFF4834R

NP_642707.1 apt-XAC2391

1

186

S=855 I=89 E=7.83594e-97

adenine phosphoribosyltransferase

XFF4834R

YP_364319.1 apt-XCV2588

1

186

S=837 I=88 E=1.04309e-94

adenine phosphoribosyltransferase

XFF4834R

NP_637638.1 apt-XCC2283

1

186

S=809 I=84 E=2.50997e-91

adenine phosphoribosyltransferase

pubmed

17

186

S=391 I=45 E=4.59419e-39

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Pubmed 19262690

 

prodomImg

pubmed

22

174

S=356 I=46 E=8.2121e-35

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Pubmed 19145256

 

prodomImg

pubmed

21

174

S=352 I=50 E=2.78333e-34

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Pubmed 8825780

 

prodomImg

pubmed

16

186

S=335 I=43 E=2.8773e-32

Adenine phosphoribosyltransferase ; Glycosyltransferase

Pubmed 16397301

 

prodomImg

pubmed

17

171

S=333 I=48 E=4.56741e-32

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Pubmed 17965706

 

prodomImg

sp_Pdown

sp|Q8PJY6|APT_XANAC

1

186

S=855 I=89 E=2.04363e-95

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

sp_Pdown

sp|Q3BSE4|APT_XANC5

1

186

S=837 I=88 E=2.72039e-93

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

sp_Pdown

sp|Q5GZA0|APT_XANOR

1

186

S=815 I=85 E=1.52628e-90

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

sp_Pdown

sp|Q2P2B0|APT_XANOM

1

186

S=815 I=85 E=1.52628e-90

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

sp_Pdown

sp|B0RS13|APT_XANCB

1

186

S=811 I=84 E=4.08798e-90

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Iprscan [G3DSA:3.40.50.2020]

9

174

-

Iprscan IPR005764 [MF_00004]

16

186

Adenine phosphoribosyl transferase

Iprscan IPR000836 [PF00156]

41

163

Phosphoribosyltransferase

Iprscan IPR005764 [TIGR01090]

18

186

Adenine phosphoribosyl transferase

Iprscan [seg]

136

152

-

PDA0J5T9

16

85

S=164 I=41 E=2.28959e-12

PD001933

81

129

S=156 I=63 E=2.02481e-11

PD546495

28

176

S=130 I=27 E=2.62357e-08

PDA3T150

1

20

S=119 I=95 E=6.60539e-07

PDA1G2U3

48

94

S=118 I=50 E=7.79547e-07

Iprscan [SSF53271]

20

182

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one iVFQGtzn)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

62 hits
swiss-prot

Swiss-Prot ncbi-blastp

639 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbBTEro/XFF4834R_chr24020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbBTEro/XFF4834R_chr24020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbBTEro/XFF4834R_chr24020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbBTEro/XFF4834R_chr24020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.