Xanthomonas fuscans subsp. fuscans

10 hits

  1. XFF4834R_chr07930XFF4834R_chr07930putative pyrophosphohydrolase
  2. XFF4834R_chr11370XFF4834R_chr11860685_1270683_f1_XFF4834R-XFF4834R_chr11370XFF4834R_chr11370probable Inosine/uridine-preferring nucleoside hydrolase
  3. XFF4834R_chr12610rihAXFF4834R_chr12610probable inosine-uridine preferring nucleoside hydrolase
  4. XFF4834R_chr23020cmkXFF4834R_chr23020probable cytidylate kinase
  5. XFF4834R_chr24020aptXFF4834R_chr24020probable adenine phosphoribosyltransferase
  6. XFF4834R_chr25320uppXFF4834R_chr25320probable uracil phosphoribosyltransferase
  7. XFF4834R_chr31650deoDXFF4834R_chr31650probable purine nucleoside phosphorylase II
  8. XFF4834R_chr31660hptXFF4834R_chr31660probable hypoxanthine phosphoribosyltransferase
  9. XFF4834R_chr34250pnuCXFF4834R_chr34250putative nicotinamide riboside transporter
  10. XFF4834R_chr41480tdkXFF4834R_chr41480probable thymidine kinase/deoxyuridine kinase

XFF4834R_chr07930
XFF4834R_chr07920
XFF4834R_chr07920
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07940
XFF4834R_chr07940
ID
AC XFF4834R_chr07930
LT XFF4834R_chr07930
OR XFF4834R_chr from 918101 to 919048 on strand +
DE putative pyrophosphohydrolase
IP NUDIX hydrolase domain; Mutator MutT protein; Aldolase-type TIM barrel; NUDIX hydrolase
CL 1.7.33 Nucleotide and nucleoside conversions GO:0015949
EC
GO InterPro
8-dihydroguanine triphosphatase activity (GO:0008413)
Biological Process: DNA repair (GO:0006281)
Biological Process: thiamin biosynthetic process (GO:0009228)
Biological Process: metabolic process (GO:0008152)
Molecular Function: thiamin-phosphate diphosphorylase activity (GO:0004789)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN Belongs to the Nudix hydrolase family
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 34836.5 Da
SQ 315 aa
 
........10........20........30........40........50
| | | | |
MPDSLRSIHVVAGVITDPRGRILLTRRTETRDMPGLWEFPGGKREPGETS
EQALVRELNEELGIEAQVGDWVMDVPQLYPDKRLRLEVRHITSWKGSPRG
REGQAMTWVAADKLARYSMPPADVPVVGALRQPDRYLITPEPEDDARWLE
GLELALHNGITRIQLRARQLAPARWQALLQQAMRLRGRARAQLLLNRDIA
QAADLGIGVHLGSEQLAGLQERPLPAEQLVAASCHGLDDLRHAQRIGCDF
AVLGPVQATASHPGATPIGWDGFETLREQVSLPIYALGGMQIEDVRKARS
HGGQGIAAIRALWPQ
XFF4834R

NP_641141.1 lcl|XAC0789-XAC0789

1

315

S=1437 I=90 E=4.78445e-167

hypothetical protein

XFF4834R

YP_362571.1 lcl|XCV0840

1

315

S=1419 I=89 E=7.91997e-165

hypothetical protein

XFF4834R

NP_636127.1 lcl|XCC0736

1

314

S=1258 I=80 E=2.37961e-145

hypothetical protein

XFF4834R

lcl|XALc_2803

1

314

S=1018 I=64 E=2.57885e-116

putative nudix hydrolase protein

pubmed

5

131

S=239 I=42 E=2.46173e-20

NTP pyrophosphohydrolase

Pubmed 18028413

 

prodomImg

pubmed

5

132

S=224 I=37 E=1.63136e-18

Mutator mutT protein EC=3.6.1.- ; DNA damage repair replication Hydrolase Magnesium

Pubmed 3033442,1630901

 

prodomImg

pubmed

6

105

S=203 I=38 E=5.37744e-16

Mutator mutT protein EC=3.6.1.- ; DNA damage repair replication Hydrolase Magnesium

Pubmed 8244038

 

prodomImg

pubmed

8

135

S=199 I=38 E=1.83854e-15

MutT ; Hydrolase

Pubmed 10844690

 

prodomImg

pubmed

8

135

S=194 I=38 E=7.61506e-15

Putative mutator protein MutT ; Hydrolase

Pubmed 10844690

 

prodomImg

pubmed

6

132

S=175 I=35 E=1.32826e-12

Putative 8-oxo-dGTPase ; Hydrolase

Pubmed 12101306

 

prodomImg

pubmed

7

131

S=155 I=31 E=3.8416e-10

Bifunctional pyrrolidone carboxyl peptidase/Nudix pyrophosphohydrolase

Pubmed 11233160

 

prodomImg

pubmed

136

313

S=147 I=23 E=3.7393e-09

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

Pubmed 17563350

 

prodomImg

pubmed

10

115

S=131 I=35 E=3.05475e-07

AtaP7 protein ; Hydrolase

Pubmed 7737149,9128724

 

prodomImg

pubmed

208

308

S=131 I=29 E=3.10848e-07

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

Pubmed 17592475

 

prodomImg

sp_Pdown

sp|P77788|NUDG_ECOLI

5

130

S=250 I=41 E=7.60642e-22

CTP pyrophosphohydrolase EC=3.6.1.- ; Magnesium Manganese

sp_Pdown

sp|P44932|MUTT_HAEIN

6

138

S=226 I=39 E=7.26373e-19

Mutator mutT protein EC=3.6.1.- ; DNA damage repair replication Hydrolase Magnesium

sp_Pdown

sp|P08337|MUTT_ECOLI

5

132

S=224 I=37 E=1.12327e-18

Mutator mutT protein EC=3.6.1.- ; DNA damage repair replication Hydrolase Magnesium

sp_Pdown

sp|O67378|Y1366_AQUAE

133

309

S=214 I=30 E=1.92702e-17

Uncharacterized protein aq_1366

sp_Pdown

sp|P32090|MUTT_PROVU

6

105

S=203 I=38 E=3.70263e-16

Mutator mutT protein EC=3.6.1.- ; DNA damage repair replication Hydrolase Magnesium

Iprscan IPR020476 [PR00502]

37

51

NUDIX hydrolase

Iprscan IPR020476 [PR00502]

51

66

NUDIX hydrolase

Iprscan IPR000086 [G3DSA:3.90.79.10]

8

114

NUDIX hydrolase domain

Iprscan IPR013785 [G3DSA:3.20.20.70]

119

313

Aldolase-type TIM barrel

Iprscan [PTHR20857:SF15]

132

312

-

Iprscan [PTHR20857]

132

312

-

Iprscan IPR003733 [PF02581]

136

312

Thiamine monophosphate synthase

Iprscan IPR000086 [PF00293]

10

115

NUDIX hydrolase domain

Iprscan IPR003561 [TIGR00586]

4

132

Mutator MutT protein

Iprscan [seg]

173

197

-

PD149806

136

312

S=174 I=33 E=1.27203e-13

PDA0P6V0

12

120

S=160 I=37 E=6.60366e-12

PDA8E381

13

79

S=150 I=40 E=1.21472e-10

PDA3G3V9

83

310

S=137 I=24 E=3.77017e-09

PDA1U0H3

110

135

S=129 I=100 E=3.51322e-08

PD931876

5

75

S=128 I=42 E=4.97927e-08

PD512096

61

109

S=120 I=47 E=4.32732e-07

PDA2D827

233

297

S=111 I=35 E=5.81564e-06

PDA9C1D8

11

69

S=109 I=44 E=8.99338e-06

PD398025

35

71

S=102 I=54 E=6.79817e-05

Iprscan IPR003733 [SSF51391]

117

313

Thiamine monophosphate synthase

Iprscan IPR015797 [SSF55811]

5

132

NUDIX hydrolase domain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0Sn6aUy3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

110 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr07930.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr07930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr07930.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr07930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr11860685_1270683_f1_XFF4834R-XFF4834R_chr11370 XFF4834R_chr11370
XFF4834R_chr11360
XFF4834R_chr11360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11390
XFF4834R_chr11390
ID XFF4834R_chr11860685_1270683_f1_XFF4834R-XFF4834R_chr11370
AC XFF4834R_chr11370
LT XFF4834R_chr11370
OR XFF4834R_chr from 1269772 to 1270683 on strand +
DE probable Inosine/uridine-preferring nucleoside hydrolase
IP Inosine/uridine-preferring nucleoside hydrolase
CL 1.7.33 Nucleotide and nucleoside conversions GO:0015949
EC
GO InterPro


Curated
PM
AN les start sont tous different chez les xantho. Je me suis plutot aligne sur xav rihC chez coli blastp: 26% sur 92% total
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100906)
MW 32469 Da
SQ 303 aa
 
........10........20........30........40........50
| | | | |
VQSTPASVQSEKVVVSTDIGDDIDDAFALGLLLRRPQLRVLGIASAWGDT
TLRVQLLQRLLQQAGRSEIPLAVGTRTTSSIAFSQARWAAKGQVPAALPD
AAAMILQQARQHPGEVTLLVLGPMTDAALAQQRDPAGFAKLKRVVAMGGS
VRVGYGKSAYRPASAPAPEYNILADVPAAQRVFSSGVPIVLLPLDATQVT
LEEPERVALFAHGDGLTDALTQLYYQWRNTDQPWASATPTLFDVVPVAWL
LRPALCPTTPLHLDVDAQGYTREGAGAPNVQACLRVDKPALIELYMRSLL
ELP
XFF4834R

XFF4834R_chr02810 XFF4834R_chr02950010_0329179_r3_XFF4834R-XFF4834R_chr02810

101

214

S=133 I=37 E=1.33119e-09

XFF4834R

XFF4834R_chr12610 rihA-XFF4834R_chr12610

10

188

S=95 I=28 E=4.94937e-05

ribonucleoside hydrolase 1

XFF4834R

NP_641480.1 XAC1144-XAC1144

8

303

S=1412 I=93 E=4.26353e-164

inosine-uridine preferring nucleoside hydrolase

XFF4834R

YP_362893.1 XCV1162

1

302

S=1373 I=91 E=2.36734e-159

putative inosine-uridine preferring nucleoside hydrolase

XFF4834R

NP_636413.1 XCC1038

3

301

S=1308 I=84 E=1.79464e-151

inosine-uridine preferring nucleoside hydrolase

XFF4834R

XALc_0644 XALc_0644

11

301

S=1026 I=68 E=2.96909e-117

putative inosine-uridine preferring nucleoside hydrolase precursor protein

XFF4834R

NP_635688.1 XCC0293

101

214

S=141 I=37 E=4.31024e-10

nucleoside hydrolase

XFF4834R

YP_362047.1 XCV0316

95

202

S=132 I=39 E=6.54472e-09

putative nucleoside hydrolase

XFF4834R

NP_640663.1 XAC0307-XAC0307

101

202

S=131 I=39 E=6.83634e-09

nucleoside hydrolase

XFF4834R

YP_365238.1 iunH-XCV3507

10

188

S=98 I=28 E=7.43427e-05

inosine-uridine preferring nucleoside hydrolase

pubmed

113

296

S=192 I=30 E=1.18736e-14

Non-specific ribonucleoside hydrolase rihC EC=3.2.-.- ; Glycosidase

Pubmed 2011499,1630901

 

prodomImg

pubmed

12

282

S=145 I=26 E=5.88146e-09

Nucleoside hydrolase

Pubmed 16707707

 

prodomImg

pubmed

10

269

S=143 I=26 E=1.21273e-08

Inosine-uridine nucleoside N-ribohydrolase

Pubmed 17449683

 

prodomImg

pubmed

12

269

S=140 I=25 E=2.80072e-08

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

pubmed

12

269

S=138 I=25 E=4.56366e-08

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

sp_Pdown

sp|A8AJF8|RIHA_CITK8

24

299

S=226 I=28 E=7.50433e-19

Pyrimidine-specific ribonucleoside hydrolase rihA EC=3.2.-.- ; Glycosidase

sp_Pdown

sp|Q8FJY8|RIHA_ECOL6

24

294

S=220 I=28 E=3.1629e-18

Pyrimidine-specific ribonucleoside hydrolase rihA EC=3.2.-.- ; Glycosidase

sp_Pdown

sp|A1A8R9|RIHA_ECOK1

24

294

S=220 I=28 E=3.1629e-18

Pyrimidine-specific ribonucleoside hydrolase rihA EC=3.2.-.- ; Glycosidase

sp_Pdown

sp|B7MFR7|RIHA_ECO45

24

294

S=220 I=28 E=3.1629e-18

Pyrimidine-specific ribonucleoside hydrolase rihA EC=3.2.-.- ; Glycosidase

sp_Pdown

sp|B7UKT4|RIHA_ECO27

24

294

S=220 I=28 E=3.1629e-18

Pyrimidine-specific ribonucleoside hydrolase rihA EC=3.2.-.- ; Glycosidase

Iprscan IPR001910 [G3DSA:3.90.245.10]

10

299

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

6

303

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PF01156]

11

299

Inosine/uridine-preferring nucleoside hydrolase

Iprscan [seg]

52

63

-

PD695370

8

99

S=345 I=78 E=2.44616e-34

PD007736

106

269

S=211 I=37 E=4.48254e-18

PDA18648

273

302

S=136 I=83 E=4.52724e-09

Iprscan IPR001910 [SSF53590]

10

299

Inosine/uridine-preferring nucleoside hydrolase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UZUukSXT)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

131 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr11370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr11370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr11370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr11370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rihA XFF4834R_chr12610
XFF4834R_chr12600
XFF4834R_chr12600
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr12620
XFF4834R_chr12620
ID rihA
AC XFF4834R_chr12610
LT XFF4834R_chr12610
OR XFF4834R_chr from 1429640 to 1430578 on strand +
DE probable inosine-uridine preferring nucleoside hydrolase
IP Inosine/uridine-preferring nucleoside hydrolase
CL 1.7.33 Nucleotide and nucleoside conversions GO:0015949
EC
GO InterPro


Curated
PM
AN chez xav iunH rien trouve je garde la nomenclature coli, rihA 33% homology sur 97% coverage
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100906)
MW 33655.8 Da
SQ 312 aa
 
........10........20........30........40........50
| | | | |
MTDKIPLLIDTDPGVDDALALLMAFNDNRHEVVGLTIAAGNVGLQYTVRN
ALKVCEIAGRDDVPVYAGCPQPLLHPSVDAAHVHGLDGFGDIGLAPSKRT
AEAEHAALAILRLSHEHAGKLLLVALGPLTNLALALTLDPTLPQRVARLV
VMGGALTGHGNITAAAEFNIGFDPEAAHIVFRGFPQFDVADWEATIAHGL
LHRDVEHWLAADSARARFYEEISRKTRLWSEDSRGEYWYAADALAMAFAL
HPEGAQRLEQRPVHIELSGAHTRGMTLVDWNRQGGTPDNANLLLAYDIQQ
FYGLVGAALAAN
XFF4834R

NP_643697.1 XAC3390-XAC3390

1

312

S=1406 I=88 E=2.74226e-163

inosine-uridine preferring nucleoside hydrolase

XFF4834R

YP_365238.1 iunH-XCV3507

1

312

S=1396 I=87 E=4.66362e-162

inosine-uridine preferring nucleoside hydrolase

XFF4834R

NP_638583.1 XCC3237

1

311

S=1246 I=81 E=5.5171e-144

inosine-uridine preferring nucleoside hydrolase

pubmed

7

309

S=332 I=32 E=1.34775e-31

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.- ; Calcium Glycosidase Metal-binding Nucleotide metabolism

Pubmed 8634237,8634238

 

prodomImg

pubmed

7

309

S=318 I=31 E=8.25735e-30

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 Nonspecific nucleoside hydrolase Nucleoside hydrolase ; Glycosidase

Pubmed 11738828,16725143

 

prodomImg

pubmed

7

309

S=318 I=31 E=8.25735e-30

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

pubmed

7

309

S=317 I=31 E=8.93139e-30

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

pubmed

7

309

S=316 I=31 E=1.22246e-29

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

sp_Pdown

sp|Q9P6J4|YHD6_SCHPO

7

302

S=345 I=33 E=2.6177e-33

Uncharacterized protein C1683.06c ; Cytoplasm Glycosidase Hydrolase Nucleus

sp_Pdown

sp|Q9SJM7|URH1_ARATH

7

237

S=335 I=35 E=3.80519e-32

Uridine nucleosidase 1 EC=3.2.2.3 ; Cytoplasm Glycosidase Hydrolase

sp_Pdown

sp|Q27546|IUNH_CRIFA

7

309

S=332 I=32 E=9.17939e-32

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.- ; Calcium Glycosidase Metal-binding Nucleotide metabolism

sp_Pdown

sp|Q6ZJ05|URH1_ORYSJ

7

283

S=312 I=32 E=2.39113e-29

Probable uridine nucleosidase 1 EC=3.2.2.3 ; Cytoplasm Glycosidase Hydrolase

sp_Pdown

sp|P83851|IUNH_LEIMA

7

309

S=312 I=31 E=2.39113e-29

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.- ; Calcium Glycosidase Metal-binding Nucleotide metabolism

Iprscan IPR001910 [G3DSA:3.90.245.10]

4

309

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

1

312

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PF01156]

5

307

Inosine/uridine-preferring nucleoside hydrolase

Iprscan [seg]

125

143

-

Iprscan [seg]

240

249

-

PDA23882

182

279

S=455 I=89 E=1.23685e-47

PD007736

31

305

S=254 I=32 E=3.00199e-23

PD610846

280

311

S=130 I=81 E=3.2347e-08

PDA4L6F6

7

90

S=116 I=34 E=1.48631e-06

Iprscan IPR001910 [SSF53590]

4

309

Inosine/uridine-preferring nucleoside hydrolase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YAL1bSP8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

39 hits
swiss-prot

Swiss-Prot ncbi-blastp

134 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr12610.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr12610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr12610.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr12610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cmk XFF4834R_chr23020
XFF4834R_chr23010
XFF4834R_chr23010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23030
XFF4834R_chr23030
ID cmk
AC XFF4834R_chr23020
LT XFF4834R_chr23020
OR XFF4834R_chr from 2667259 to 2667942 on strand -
DE probable cytidylate kinase
IP Cytidylate kinase; Cytidylate kinase region
CL 1.7.33.4 Salvage pathways of pyrimidine ribonucleotides
EC
GO InterPro
Molecular Function: ATP binding (GO:0005524)
Molecular Function: cytidylate kinase activity (GO:0004127)
nucleotide and nucleic acid metabolic process (GO:0006139)

Curated
PM
AN gene localise dans l operon rpsA
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100906)
MW 24155.2 Da
SQ 227 aa
 
........10........20........30........40........50
| | | | |
MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWA
DLDVSDPAALVRCTFDTKVEFDDAGEAGLRVLVNGVDATGELRLETTGAL
ASAIAAIPEVRSALKERQRAFRRAPGLVADGRDMGTVIFPDAAFKVFLTA
SAEERAGRRHKQLMEKGVSVIFDDLLREIMARDARDAQRVVAPLRPAEDA
VLIDTSGMGIEDVVQRVVGLLADRTPS
XFF4834R

NP_642616.1 lcl|cmk-XAC2299

1

227

S=1055 I=93 E=5.13963e-121

cytidylate kinase

XFF4834R

YP_364228.1 lcl|cmk-XCV2497

1

226

S=1051 I=92 E=2.00275e-120

cytidylate kinase

XFF4834R

NP_637551.1 lcl|cmk-XCC2195

1

226

S=1030 I=91 E=5.64281e-118

cytidylate kinase

XFF4834R

lcl|cmk-XALc_1603

1

221

S=866 I=78 E=4.27216e-98

probable cytidylate kinase protein

pubmed

1

219

S=513 I=48 E=9.94715e-54

Cytidylate kinase ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 17400574

 

prodomImg

pubmed

1

218

S=512 I=49 E=1.15364e-53

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 6384724

 

prodomImg

pubmed

8

222

S=384 I=36 E=4.51749e-38

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 10217496

 

prodomImg

pubmed

8

218

S=379 I=37 E=1.90401e-37

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 7704259

 

prodomImg

pubmed

8

224

S=373 I=37 E=8.30978e-37

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 19014707

 

prodomImg

pubmed

8

225

S=373 I=37 E=8.45595e-37

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 19124572

 

prodomImg

pubmed

8

224

S=340 I=35 E=8.95813e-33

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 18281406

 

prodomImg

pubmed

8

223

S=339 I=33 E=1.03893e-32

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 17592475

 

prodomImg

pubmed

8

225

S=332 I=30 E=8.71957e-32

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 18359806

 

prodomImg

pubmed

8

224

S=329 I=36 E=2.08519e-31

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 10484179

 

prodomImg

sp_Pdown

sp|Q8PK76|KCY_XANAC

1

227

S=1055 I=93 E=1.26932e-119

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q3BSN5|KCY_XANC5

1

226

S=1051 I=92 E=4.94612e-119

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|B0RSA3|KCY_XANCB

1

226

S=1041 I=92 E=8.05278e-118

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q5H0T8|KCY_XANOR

1

227

S=1033 I=91 E=7.12151e-117

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|B2SLH6|KCY_XANOP

1

227

S=1033 I=91 E=7.12151e-117

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

PD005731

108

211

S=297 I=57 E=1.7451e-28

PD600108

55

98

S=195 I=89 E=4.27824e-16

PD709777

7

46

S=170 I=78 E=4.57582e-13

PDA4V051

193

227

S=155 I=89 E=3.00602e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FU0D7kh3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

449 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr23020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr23020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr23020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr23020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
apt XFF4834R_chr24020
XFF4834R_chr24010
XFF4834R_chr24010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24030
XFF4834R_chr24030
ID apt
AC XFF4834R_chr24020
LT XFF4834R_chr24020
OR XFF4834R_chr from 2769399 to 2769959 on strand -
DE probable adenine phosphoribosyltransferase
IP Phosphoribosyltransferase
CL 1.7.33.1 Salvage pathways of adenine, hypoxanthine, and their nucleosides
EC
GO InterPro
Biological Process: adenine salvage (GO:0006168)
Biological Process: nucleoside metabolic process (GO:0009116)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: adenine phosphoribosyltransferase activity (GO:0003999)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100906)
MW 20149.9 Da
SQ 186 aa
 
........10........20........30........40........50
| | | | |
MTDCSRCAGTNTSGPNHWSERIRDIVDFPKPGIVFKDITPLLSDGPDFAS
ALDEMAQPWRTTPLDAVLGIEARGFILGAALARELRTGFVPVRKPGKLPG
RTLIQEYALEYGTDRIEMHEDALPRGARVLIVDDVLATGGTLRAALGLAA
QLEFEVVGAAVLVELQGLQGRQKWVNDVPLLATLSY
XFF4834R

NP_642707.1 apt-XAC2391

1

186

S=855 I=89 E=7.83594e-97

adenine phosphoribosyltransferase

XFF4834R

YP_364319.1 apt-XCV2588

1

186

S=837 I=88 E=1.04309e-94

adenine phosphoribosyltransferase

XFF4834R

NP_637638.1 apt-XCC2283

1

186

S=809 I=84 E=2.50997e-91

adenine phosphoribosyltransferase

pubmed

17

186

S=391 I=45 E=4.59419e-39

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Pubmed 19262690

 

prodomImg

pubmed

22

174

S=356 I=46 E=8.2121e-35

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Pubmed 19145256

 

prodomImg

pubmed

21

174

S=352 I=50 E=2.78333e-34

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Pubmed 8825780

 

prodomImg

pubmed

16

186

S=335 I=43 E=2.8773e-32

Adenine phosphoribosyltransferase ; Glycosyltransferase

Pubmed 16397301

 

prodomImg

pubmed

17

171

S=333 I=48 E=4.56741e-32

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Pubmed 17965706

 

prodomImg

sp_Pdown

sp|Q8PJY6|APT_XANAC

1

186

S=855 I=89 E=2.04363e-95

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

sp_Pdown

sp|Q3BSE4|APT_XANC5

1

186

S=837 I=88 E=2.72039e-93

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

sp_Pdown

sp|Q5GZA0|APT_XANOR

1

186

S=815 I=85 E=1.52628e-90

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

sp_Pdown

sp|Q2P2B0|APT_XANOM

1

186

S=815 I=85 E=1.52628e-90

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

sp_Pdown

sp|B0RS13|APT_XANCB

1

186

S=811 I=84 E=4.08798e-90

Adenine phosphoribosyltransferase EC=2.4.2.7 ; Cytoplasm Glycosyltransferase Purine salvage

Iprscan [G3DSA:3.40.50.2020]

9

174

-

Iprscan IPR005764 [MF_00004]

16

186

Adenine phosphoribosyl transferase

Iprscan IPR000836 [PF00156]

41

163

Phosphoribosyltransferase

Iprscan IPR005764 [TIGR01090]

18

186

Adenine phosphoribosyl transferase

Iprscan [seg]

136

152

-

PDA0J5T9

16

85

S=164 I=41 E=2.28959e-12

PD001933

81

129

S=156 I=63 E=2.02481e-11

PD546495

28

176

S=130 I=27 E=2.62357e-08

PDA3T150

1

20

S=119 I=95 E=6.60539e-07

PDA1G2U3

48

94

S=118 I=50 E=7.79547e-07

Iprscan [SSF53271]

20

182

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 2sC2w82g)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

62 hits
swiss-prot

Swiss-Prot ncbi-blastp

639 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr24020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr24020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr24020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr24020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
upp XFF4834R_chr25320
XFF4834R_chr25310
XFF4834R_chr25310
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25330
XFF4834R_chr25330
ID upp
AC XFF4834R_chr25320
LT XFF4834R_chr25320
OR XFF4834R_chr from 2922523 to 2923155 on strand +
DE probable uracil phosphoribosyltransferase
IP Uracil phosphoribosyl transferase
CL 1.7.33.4 Salvage pathways of pyrimidine ribonucleotides
EC
GO InterPro
Biological Process: uracil salvage (GO:0006223)
Biological Process: nucleoside metabolic process (GO:0009116)
Molecular Function: uracil phosphoribosyltransferase activity (GO:0004845)

Curated
PM
AN ai change le start enleve 41 aa, hamap upp disparu apres le changement de start
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: acur
CC STATUS: curated by brin (20100906)
MW 22607.1 Da
SQ 210 aa
 
........10........20........30........40........50
| | | | |
MKIVEVRHPLVQHKIGLLRDAALSTKGFRELVTELGTLLAYEATANLDTE
SHTQPGWAGPVTVQRIAGAKITLVPILRAGLGMLPGVLALIPAARVSVVG
LQRDEETLQPVPYFERLTGRLEERDALILDPMLATGGTLIATIDMLKRAG
ARRIKGIFLVAAPEGLKALEAVHPDVEVYTAAIDDHLNDKGYILPGLGDA
GDRIFGTRLE
XFF4834R

YP_364434.1 upp-XCV2703

1

210

S=1060 I=100 E=1.44531e-121

uracil phosphoribosyltransferase

XFF4834R

NP_642836.1 upp-XAC2521

1

210

S=1058 I=100 E=2.29428e-121

uracil phosphoribosyltransferase

XFF4834R

NP_637740.1 upp-XCC2386

1

210

S=1044 I=98 E=1.04505e-119

uracil phosphoribosyltransferase

pubmed

1

208

S=746 I=66 E=5.62087e-82

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 1371255

 

prodomImg

pubmed

1

208

S=714 I=65 E=3.62266e-78

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 19675025

 

prodomImg

pubmed

8

208

S=698 I=64 E=3.25735e-76

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 19187283

 

prodomImg

pubmed

6

208

S=580 I=55 E=6.81437e-62

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 7961396

 

prodomImg

pubmed

2

208

S=562 I=53 E=1.12802e-59

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Pubmed 9268683,12037295

 

prodomImg

sp_Pdown

sp|Q3BS29|UPP_XANC5

1

210

S=1060 I=100 E=3.88197e-120

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

sp_Pdown

sp|P59001|UPP_XANAC

1

210

S=1058 I=100 E=6.16222e-120

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

sp_Pdown

sp|Q9RBJ3|UPP_XANCP

1

210

S=1044 I=98 E=2.8069e-118

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

sp_Pdown

sp|B0RRQ3|UPP_XANCB

1

210

S=1044 I=98 E=2.8069e-118

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

sp_Pdown

sp|Q4UVY0|UPP_XANC8

1

210

S=1044 I=98 E=2.8069e-118

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Allosteric enzyme Glycosyltransferase GTP-binding Magnesium Nucleotide-binding

Iprscan [G3DSA:3.40.50.2020]

6

208

-

Iprscan [PTHR10285:SF1]

1

207

-

Iprscan [PTHR10285]

1

207

-

Iprscan IPR000836 [PF00156]

64

159

Phosphoribosyltransferase

Iprscan IPR005765 [TIGR01091]

2

208

Uracil phosphoribosyl transferase

PD847129

66

138

S=224 I=64 E=1.1421e-19

PD580329

166

208

S=169 I=67 E=5.00305e-13

PD003612

2

48

S=153 I=64 E=4.61775e-11

PDA1V3Z2

139

165

S=130 I=100 E=3.22178e-08

PDA082Z8

116

184

S=117 I=35 E=9.65679e-07

PDA816W0

139

169

S=107 I=65 E=1.67117e-05

Iprscan [SSF53271]

3

208

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jDsYZZbl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

52 hits
swiss-prot

Swiss-Prot ncbi-blastp

515 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr25320.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr25320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr25320.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr25320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
deoD XFF4834R_chr31650
XFF4834R_chr31640
XFF4834R_chr31640
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31660
XFF4834R_chr31660
ID deoD
AC XFF4834R_chr31650
LT XFF4834R_chr31650
OR XFF4834R_chr from 3634480 to 3635232 on strand -
DE probable purine nucleoside phosphorylase II
IP Nucleoside phosphorylase; Purine phosphorylase, family 2, conserved site
CL 1.7.33.2 Salvage pathways of guanine, xanthine, and their nucleosides
EC
GO InterPro
Biological Process: nucleoside metabolic process (GO:0009116)
Molecular Function: catalytic activity (GO:0003824)
transferring pentosyl groups (GO:0016763)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 26194.7 Da
SQ 250 aa
 
........10........20........30........40........50
| | | | |
MSANSIALAVIGGTGVYKLAQLDDVQSHDIQTPYGAPSGPIRVGMLLGHR
VAFLARHGEGHSLPPHKVNYRANIAALQQIGASRVLALNTVGGITEQFGP
RVLACPDQLIDYTWGRVSTFCEEPGSEVQHVDFGHPYSPMFRSKVIAAAK
VTGVTLVAGGCYGATQGPRLETVAEIARMRRDGCDLVGMTGMPEAGLARE
KGLEYACLAIVANWAAGCGDAQEITMAEVLANVDAASSGLPELIGELARG
Show or not Domain decomposition
 
XFF4834R

NP_641671.1 lcl|deoD-XAC1336

1

250

S=1303 I=99 E=5.69916e-151

5'-methylthioadenosine phosphorylase

XFF4834R

YP_363119.1 lcl|deoD-XCV1388

1

250

S=1301 I=99 E=9.70036e-151

5'-methylthioadenosine phosphorylase

XFF4834R

NP_636659.1 lcl|deoD-XCC1285

1

250

S=1264 I=94 E=3.483e-146

5'-methylthioadenosine phosphorylase

XFF4834R

lcl|XALc_2532

4

250

S=1116 I=83 E=2.8076e-128

putative purine-nucleoside phosphorylase protein

pubmed

8

240

S=410 I=42 E=3.73852e-41

5'-fluoro-5'-deoxy-adenosine phosphorylase

Pubmed 16720268

 

prodomImg

pubmed

6

214

S=385 I=39 E=3.30066e-38

Putative 5'-methylthioadenosine phosphorylase

Pubmed 14617179

 

prodomImg

pubmed

29

232

S=335 I=41 E=4.15585e-32

Probable 5'-methylthioadenosine phosphorylase

Pubmed 16581904

 

prodomImg

pubmed

2

244

S=313 I=30 E=2.06372e-29

S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Cytoplasm Glycosyltransferase Phosphoprotein Polymorphism

Pubmed 7604019,8650244

 

prodomImg

pubmed

2

214

S=310 I=33 E=4.64298e-29

S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Cytoplasm Glycosyltransferase Phosphoprotein

Pubmed 12824877

 

prodomImg

pubmed

5

233

S=305 I=32 E=1.67268e-28

Multicopy enhancer of UAS2 ; Glycosyltransferase

Pubmed 8807288

 

prodomImg

pubmed

5

233

S=305 I=32 E=1.95691e-28

YLR017W

Pubmed 17322287

 

prodomImg

pubmed

26

131

S=262 I=52 E=2.57587e-23

Nucleoside phosphorylase

Pubmed 15607633

 

prodomImg

pubmed

26

131

S=262 I=52 E=2.66729e-23

Nucleoside phosphorylase

Pubmed 15607633

 

prodomImg

pubmed

30

210

S=255 I=35 E=2.05169e-22

Methylthioadenosine phosphorylase MTAP

Pubmed 16373569

 

prodomImg

sp_Pdown

sp|Q87BR7|MTNP_XYLFT

4

249

S=1017 I=76 E=7.549e-115

Probable S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Amino-acid biosynthesis Glycosyltransferase Methionine

sp_Pdown

sp|Q9PAZ2|MTNP_XYLFA

4

233

S=986 I=78 E=3.55467e-111

Probable S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Amino-acid biosynthesis Glycosyltransferase Methionine

sp_Pdown

sp|Q87ZC3|MTNP_PSESM

9

229

S=606 I=57 E=3.79799e-65

Probable S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Amino-acid biosynthesis Glycosyltransferase Methionine

sp_Pdown

sp|Q9HZK1|MTNP_PSEAE

9

229

S=582 I=55 E=3.82167e-62

Probable S-methyl-5'-thioadenosine phosphorylase EC=2.4.2.28 ; Amino-acid biosynthesis Glycosyltransferase Methionine

sp_Pdown

sp|O57865|Y125_PYRHO

8

224

S=435 I=42 E=1.9748e-44

Uncharacterized protein PH0125 ; Glycosyltransferase

PDA1V4L2

218

250

S=162 I=100 E=3.63323e-12

PD005375

6

61

S=160 I=52 E=6.86607e-12

PDA2M418

8

110

S=149 I=32 E=1.36609e-10

PD003195

136

228

S=143 I=39 E=7.09788e-10

PDA42944

58

120

S=114 I=41 E=2.66434e-06

PDA1F870

63

94

S=109 I=56 E=1.06572e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9OzhMfCL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr31650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr31650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr31650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKSzabg/XFF4834R_chr31650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
hpt XFF4834R_chr31660
XFF4834R_chr31650
XFF4834R_chr31650
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31670
XFF4834R_chr31670
ID hpt
AC XFF4834R_chr31660
LT XFF4834R_chr31660
OR XFF4834R_chr from 3635315 to 3635869 on strand -
DE probable hypoxanthine phosphoribosyltransferase
IP Phosphoribosyltransferase
CL 1.7.33.2 Salvage pathways of guanine, xanthine, and their nucleosides
EC
GO InterPro
Biological Process: nucleoside metabolic process (GO:0009116)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 20176.9 Da
SQ 184 aa
 
........10........20........30........40........50
| | | | |
MSTLTISQALAQADLLVDRPAIDAAVATIADAIARDYAGEVPVYLTIMHG
ALPFSGQLALELGARGQDLQFDYLHATRYRGETTGGELVWKHRPATALFG
RRVILVDDILDEGYTLQGVRQWCLEQGATDVRVAVLTVKRHDRCVPGVTA
DYVGVEVPDRYVFGFGMDVNEQLRGIPAIYAMKQ
XFF4834R

YP_363118.1 hpt-XCV1387

1

184

S=869 I=91 E=1.63193e-98

hypoxanthine-guanine phosphoribosyltransferase

XFF4834R

NP_641670.1 hpt-XAC1335

1

184

S=869 I=91 E=1.63193e-98

hypoxanthine-guanine phosphoribosyltransferase

XFF4834R

NP_636658.1 hpt-XCC1284

1

184

S=862 I=91 E=1.00068e-97

hypoxanthine-guanine phosphoribosyltransferase

XFF4834R

XALc_2533 XALc_2533

1

184

S=742 I=76 E=3.85399e-83

putative phosphoribosyltransferase protein

pubmed

37

183

S=198 I=32 E=1.08277e-15

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Pubmed 1465108

 

prodomImg

pubmed

43

179

S=173 I=25 E=1.28582e-12

Hypoxanthine-guanine phosphoribosyltransferase ; Glycosyltransferase

Pubmed 16113341

 

prodomImg

pubmed

43

184

S=170 I=30 E=3.0482e-12

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Pubmed 15113653

 

prodomImg

pubmed

37

184

S=168 I=28 E=4.79669e-12

Hypoxanthine-guanine-xanthine phosphoribosyltransferase EC=2.4.2.- ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Pubmed 8008020,8679528

 

prodomImg

pubmed

43

184

S=167 I=30 E=6.62281e-12

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Pubmed 1783384,1781355

 

prodomImg

sp_Pdown

sp|Q8DRP8|HPRT_STRR6

37

184

S=217 I=32 E=3.3948e-18

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

sp_Pdown

sp|Q97TC4|HPRT_STRPN

37

184

S=217 I=32 E=3.3948e-18

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

sp_Pdown

sp|Q5M6K8|HPRT_STRT2

37

184

S=210 I=32 E=2.75154e-17

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

sp_Pdown

sp|Q5M216|HPRT_STRT1

37

184

S=210 I=32 E=2.75154e-17

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

sp_Pdown

sp|Q8E2H3|HPRT_STRA5

37

184

S=207 I=32 E=5.43155e-17

Hypoxanthine-guanine phosphoribosyltransferase EC=2.4.2.8 ; Cytoplasm Glycosyltransferase Magnesium Metal-binding Purine salvage

Iprscan [G3DSA:3.40.50.2020]

14

184

-

Iprscan [PTHR22573:SF9]

22

184

-

Iprscan [PTHR22573]

22

184

-

Iprscan IPR000836 [PF00156]

16

136

Phosphoribosyltransferase

Iprscan [seg]

21

36

-

PDA1M1A2

1

68