Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr01950poxBXFF4834R_chr01950probable pyruvate dehydrogenase
  2. XFF4834R_chr11770maeBXFF4834R_chr11770Probable NAD-dependent malic enzyme

poxB XFF4834R_chr01950
XFF4834R_chr01940
XFF4834R_chr01940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01960
XFF4834R_chr01960
ID poxB
AC XFF4834R_chr01950
LT XFF4834R_chr01950
OR XFF4834R_chr from 231036 to 232763 on strand +
DE probable pyruvate dehydrogenase
IP TPP-binding enzymes, conserved site; Thiamine pyrophosphate enzyme, central region; Thiamine pyrophosphate enzyme, N-terminal TPP binding region
CL 1.7.28 Pyruvate catabolism GO:0042867
EC
GO InterPro
Molecular Function: magnesium ion binding (GO:0000287)
Molecular Function: thiamin pyrophosphate binding (GO:0030976)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: transferase activity (GO:0016740)

Curated
PM
AN
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110304)
MW 61926.7 Da
SQ 575 aa
 
........10........20........30........40........50
| | | | |
MAKKRTLARFLAETLQSAGVERIWGVTGDSLNGLTDALREMQTIEWMHVR
HEEVAAFAAGAEAAVTGELAVCAGSCGPGNLHLINGLFDCHRSRQPVLAI
AAHIPSSEIGLSYFQETHPQELFRECSHFVELVTNPAQLPEVLHRAMRSA
ILQQGVAVVVIPGDIALLEVDKHVSSAWPALRQPRVLPAAEDVQQLAELL
QQSKAVTVLCGSGCAGAHDAVVALADTLGAPVVHALRGKEYVEWDNPFDV
GMTGLIGFSSGYHAMLNCDTLLMLGTDFPYRQFYPKDATIVQVDRDPSAL
GRRTPLQLGIAADVGETIAALLPQLQRREERGFLEKSLAHYRKAREGLDD
LAVPADPGEPLHPQFVTRLISQIADQDAVFTCDVGTPTVWAARYLRMNGK
RRLLGSFNHGSMANAMPQALGAQAAFPGRQVISLSGDGGFAMLMGDFISL
AQLNLPVKVVVFNNASLGFVAMEMKAAGYLDTGTELRNPDFAAMSNAMGI
LGIRVDESSQLERALRQVFAHSGPALVDVRVATQELAVPPAIKLEQAKGM
GLYLLKAVMSGRGDEVIALVKTNLR
XFF4834R

XFF4834R_chr11950 lcl|ilvB-XFF4834R_chr11950

5

531

S=404 I=26 E=3.81579e-42

acetolactate synthase I, large subunit

XFF4834R

YP_361961.1 lcl|poxB-XCV0230

1

575

S=2885 I=95 E=0

pyruvate dehydrogenase

XFF4834R

NP_640580.1 lcl|poxB-XAC0224

1

575

S=2884 I=95 E=0

pyruvate dehydrogenase

XFF4834R

NP_635601.1 lcl|poxB-XCC0206

1

575

S=2783 I=90 E=0

pyruvate dehydrogenase

XFF4834R

lcl|ilvG-XALc_0758

5

531

S=466 I=28 E=4.18715e-49

probable acetolactate synthase isozyme II large subunit protein

XFF4834R

NP_638670.1 lcl|ilvG-XCC3324

2

531

S=431 I=27 E=7.48451e-45

acetolactate synthase 2 catalytic subunit

XFF4834R

YP_365311.1 lcl|ilvG-XCV3580

5

531

S=406 I=26 E=7.40097e-42

acetolactate synthase 2 catalytic subunit

XFF4834R

NP_643759.1 lcl|ilvG-XAC3452

5

531

S=405 I=26 E=9.28406e-42

acetolactate synthase 2 catalytic subunit

pubmed

4

573

S=1931 I=61 E=0

Pyruvate dehydrogenase [cytochrome] EC=1.2.2.2 ; Cell membrane FAD Flavoprotein Lipid-binding Magnesium Oxidoreductase Thiamine pyrophosphate

Pubmed 3016647

 

prodomImg

pubmed

175

573

S=1704 I=79 E=0

PoxB ; Thiamine pyrophosphate

Pubmed 15960662

 

prodomImg

pubmed

5

575

S=855 I=32 E=1.30996e-94

Putative enzyme with pyruvate as substrate YdaP protein ; Thiamine pyrophosphate

Pubmed 9341680

 

prodomImg

pubmed

11

562

S=761 I=29 E=3.35736e-83

CidC ; Thiamine pyrophosphate

Pubmed 12670989

 

prodomImg

pubmed

4

539

S=606 I=28 E=1.58869e-64

Pyruvate oxidase EC=1.2.3.3 ; FAD Flavoprotein Magnesium Metal-binding Oxidoreductase Thiamine pyrophosphate

Pubmed 8820650

 

prodomImg

pubmed

13

528

S=602 I=30 E=5.43172e-64

Pyruvate oxidase EC=1.2.3.3 ; FAD Flavoprotein Magnesium Metal-binding Oxidoreductase Thiamine pyrophosphate

Pubmed 8145244

 

prodomImg

pubmed

4

539

S=600 I=28 E=1.08161e-63

SpxB ; Thiamine pyrophosphate

Pubmed 15576764

 

prodomImg

pubmed

13

528

S=599 I=30 E=1.2654e-63

Pyruvate oxidase ; Thiamine pyrophosphate

Pubmed 15175288

 

prodomImg

pubmed

4

539

S=598 I=28 E=1.8571e-63

SpxB ; Thiamine pyrophosphate

Pubmed 15576764

 

prodomImg

pubmed

4

539

S=506 I=27 E=2.41116e-52

Acetohydroxy acid synthase large subunit EC=4.1.3.18 ; Lyase

Pubmed 14702326

 

prodomImg

sp_Pdown

sp|Q47520|POXB_ECOLI

4

573

S=1931 I=61 E=0

Pyruvate dehydrogenase [cytochrome] EC=1.2.2.2 ; Cell membrane FAD Flavoprotein Lipid-binding Magnesium Oxidoreductase Thiamine pyrophosphate

sp_Pdown

sp|P10343|YI42_PSEAY

1

351

S=1177 I=64 E=7.10593e-134

Uncharacterized 42.6 kDa protein in isoamylase 3'region

sp_Pdown

sp|Q54970|POXB_STRPN

4

539

S=606 I=28 E=1.09305e-64

Pyruvate oxidase EC=1.2.3.3 ; FAD Flavoprotein Magnesium Metal-binding Oxidoreductase Thiamine pyrophosphate

Iprscan [G3DSA:3.40.50.970]

3

185

-

Iprscan [G3DSA:3.40.50.1220]

184

347

-

Iprscan [G3DSA:3.40.50.970]

356

540

-

Iprscan IPR012001 [PF02776]

5

174

Thiamine pyrophosphate enzyme, N-terminal TPP binding region

Iprscan IPR012000 [PF00205]

193

321

Thiamine pyrophosphate enzyme, central region

Iprscan IPR011766 [PF02775]

383

529

Thiamine pyrophosphate enzyme, C-terminal TPP-binding

Iprscan IPR000399 [PS00187]

420

439

TPP-binding enzymes, conserved site

Iprscan [seg]

52

71

-

PD000397

360

544

S=240 I=36 E=1.53872e-21

PD949944

4

51

S=206 I=77 E=1.90709e-17

PDA4Q0Z7

146

263

S=198 I=39 E=1.93902e-16

PD000376

2

165

S=192 I=28 E=1.02519e-15

PDA1F1A7

530

575

S=184 I=78 E=1.06998e-14

PDA372I4

100

164

S=177 I=49 E=6.33609e-14

PD525910

317

356

S=151 I=70 E=9.19502e-11

PD879467

251

313

S=141 I=43 E=1.79784e-09

PDA1H4C7

240

262

S=128 I=91 E=5.53156e-08

PDA8J753

291

408

S=127 I=31 E=6.99976e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one I6XMd35T)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

154 hits
swiss-prot

Swiss-Prot ncbi-blastp

95 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf_8Mjo/XFF4834R_chr01950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf_8Mjo/XFF4834R_chr01950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf_8Mjo/XFF4834R_chr01950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf_8Mjo/XFF4834R_chr01950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
maeB XFF4834R_chr11770
XFF4834R_chr11760
XFF4834R_chr11760
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4641
XFF4834R_chr_4641
ID maeB
AC XFF4834R_chr11770
LT XFF4834R_chr11770
OR XFF4834R_chr from 1316195 to 1318504 on strand +
DE Probable NAD-dependent malic enzyme
IP Malic enzyme, phosphate acetyl/butaryl transferase; NAD(P)-binding domain
CL 1.7.28 Pyruvate catabolism GO:0042867
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: acyltransferase activity (GO:0008415)
Molecular Function: metal ion binding (GO:0046872)
Molecular Function: binding (GO:0005488)
Molecular Function: NAD or NADH binding (GO:0051287)
NAD or NADP as acceptor (GO:0016616)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100817)
MW 83694.4 Da
SQ 769 aa
 
........10........20........30........40........50
| | | | |
MSTDDFKQAALDYHRQQPAGKIKVTATKPMLTQRDLSLAYSPGVAFACEA
IVEDATQASELTARGNLVAVISNGTAVLGLGNIGPLASKPVMEGKGVLFQ
KFAGIDVFDIEINENDPDKLVDIIASLEPTFGGINLEDIKAPECFIVERK
LRERMNIPVFHDDQHGTAIIVGAAVLNALVVTGKKIEEVKLATTGMGAAG
ISCVNMLVSLGLKPENILALDRDGVIHTGRTDLDPDKQRYARDTDKRTLA
EIVEGADIFLGLSAAGILKPEMVASMARQPVIFALANPNPEITPEAAKAV
RPDCIIGTGRSDYPNQINNVLCFPYLFRGALDVGATGINEEMKIACVKAI
AAMARREASDLGAAYGGETPSFGPEYLIPRPLDPRLLVELSSAVAQAAMD
SGVATRPITDMEAYRDKLGQFVYRTSLMMKPVYDRARADKQRVVYAEGEE
EVVLRAVQNVVDEGLAYPILIGRPDVIEARIERMGLRLTAGVDFEITNIL
DDPRFNDYWQYYHALTERRGVTVTAAKELMRSRPTLIAAVMVARGEADAM
LSGVVGRFHKKLGYARSVIPLEPRVSSTSAMTGVINQLGVFFFLDTHVQE
DPTVEQVVEATLQAAYRLKLFGIEPNIALLSHSNFGSHDSRDALKMRQVR
EALLKRKPELNIDGEMQGDTAWDEALRKQIMPNSTLKGRANLFVLPNLEA
ANIAYNLVRVFTDGVAIGPILMGISKPVHILTTSATSRRVMNMTAIAAVD
AQIRRQRDAEKTAADKGSD
XFF4834R

NP_643777.2 lcl|maeB-XAC3470

1

769

S=4047 I=99 E=0

malic enzyme

XFF4834R

YP_365329.1 lcl|maeB-XCV3598

1

769

S=4040 I=99 E=0

malic enzyme

XFF4834R

NP_638691.2 lcl|maeB-XCC3345

1

766

S=3920 I=97 E=0

malic enzyme

XFF4834R

lcl|maeB-XALc_0739

1

761

S=3776 I=93 E=0

probable nadp-dependent malic enzyme protein

pubmed

4

752

S=2333 I=59 E=0

NADP-dependent malic enzyme EC=1.1.1.40 ; Metal-binding Multifunctional Oxidoreductase

Pubmed 10464203

 

prodomImg

pubmed

2

752

S=2122 I=56 E=0

NAD-dependent malic enzyme EC=1.1.1.39 ; Allosteric Metal-binding Multifunctional Oxidoreductase

Pubmed 9535928

 

prodomImg

pubmed

3

757

S=2015 I=55 E=0

Malic enzyme EC=1.1.1.39 ; Metal-binding Oxidoreductase

Pubmed 20057150

 

prodomImg

pubmed

8

751

S=1553 I=44 E=4.66553e-179

NADP-dependent malic enzyme EC=1.1.1.40 ; Metal-binding Multifunctional Oxidoreductase

Pubmed 9535928

 

prodomImg

pubmed

4

393

S=1357 I=70 E=2.64026e-155

Putative uncharacterized protein ; Metal-binding Oxidoreductase

Pubmed 11728725

 

prodomImg

sp_Pdown

sp|P76558|MAO2_ECOLI

4

754

S=2337 I=59 E=0

NADP-dependent malic enzyme EC=1.1.1.40 ; Acetylation Metal-binding Multifunctional Oxidoreductase

sp_Pdown

sp|Q9ZFV8|MAO2_SALTY

4

752

S=2333 I=59 E=0

NADP-dependent malic enzyme EC=1.1.1.40 ; Metal-binding Multifunctional Oxidoreductase

sp_Pdown

sp|P43837|MAO2_HAEIN

3

752

S=2277 I=59 E=0

NADP-dependent malic enzyme EC=1.1.1.40 ; Metal-binding Multifunctional Oxidoreductase

sp_Pdown

sp|O30807|MAO1_RHIME

2

752

S=2122 I=56 E=0

NAD-dependent malic enzyme EC=1.1.1.39 ; Allosteric Metal-binding Multifunctional Oxidoreductase

sp_Pdown

sp|O30808|MAO2_RHIME

8

751

S=1553 I=44 E=3.17788e-179

NADP-dependent malic enzyme EC=1.1.1.40 ; Metal-binding Multifunctional Oxidoreductase

Iprscan [G3DSA:3.40.50.10380]

3

161

-

Iprscan IPR016040 [G3DSA:3.40.50.720]

164

422

NAD(P)-binding domain

Iprscan IPR012188 [PIRSF036684]

1

756

Malic enzyme, phosphate acetyl/butaryl transferase

Iprscan [PTHR23406:SF2]

3

442

-

Iprscan [PTHR23406]

3

442

-

Iprscan IPR002505 [PF01515]

428

748

Phosphate acetyl/butaryl transferase

Iprscan IPR012302 [PF03949]

164

399

Malic enzyme, NAD-binding

Iprscan IPR012301 [PF00390]

20

152

Malic enzyme, N-terminal

PD002789

432

751

S=565 I=43 E=8.49469e-61

PD005834

135

185

S=209 I=73 E=1.44436e-17

PD361637

303

404

S=197 I=55 E=3.27525e-16

PD064098

1

65

S=180 I=54 E=3.99584e-14

PD001213

195

273

S=167 I=47 E=1.68275e-12

PD968981

65

100

S=158 I=86 E=1.94996e-11

PDA1T2Y5

186

219

S=150 I=88 E=1.58048e-10

PD590688

381

418

S=139 I=68 E=3.58391e-09

PD128460

403

437

S=134 I=71 E=1.73666e-08

PDA260K1

186

213

S=133 I=96 E=2.21685e-08

Iprscan [SSF53659]

426

756

-

Iprscan IPR016040 [SSF51735]

164

459

NAD(P)-binding domain

Iprscan [SSF53223]

9

162

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one sEoDgq6J)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

119 hits
swiss-prot

Swiss-Prot ncbi-blastp

143 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf_8Mjo/XFF4834R_chr11770.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf_8Mjo/XFF4834R_chr11770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf_8Mjo/XFF4834R_chr11770.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBf_8Mjo/XFF4834R_chr11770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.