Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr29920pdxKXFF4834R_chr29920probable pyridoxine kinase

pdxK XFF4834R_chr29920
XFF4834R_chr29910
XFF4834R_chr29910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29930
XFF4834R_chr29930
ID pdxK
AC XFF4834R_chr29920
LT XFF4834R_chr29920
OR XFF4834R_chr from 3438059 to 3438967 on strand -
DE probable pyridoxine kinase
IP Pyridoxal phosphate (active vitamin B6) biosynthesis, pyridoxal kinase; Phosphomethylpyrimidine kinase type-1
CL 1.7.27 Pyridoxal 5'-phosphate salvage GO:0009443
EC
GO InterPro
Biological Process: pyridoxine biosynthetic process (GO:0008615)
Molecular Function: pyridoxal kinase activity (GO:0008478)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100409)
MW 31941.1 Da
SQ 302 aa
 
........10........20........30........40........50
| | | | |
MSDATDSHLVHGRRQRPDGPSPIDVISVQSQLVYGHAGNSAAAPPLRALG
LRVAEVPTTLLSNAPFYATLRGRILPADWLADLLLGATERGLPQRARMLV
SGYFGSLANGETFADWLAQILPQAQQLRYCLDPVIGDTHTGPYVEPGLER
VFAERLLPHAWLVTPNAFELGRLTGLPSLQQDDAIAAARALLARGPQWVL
AHSVAGAAGELVTLAVSDAAVYRWASPHLPVDVAGTGDVLMALLIGFLLR
DVPFEQAVGHALSGVHSALEATLAAGFEEFDVLAAAPAALAATPRFAVER
LA
Show or not Domain decomposition
 
XFF4834R

YP_363297.1 lcl|pdxY-XCV1566

1

302

S=1289 I=86 E=3.52106e-149

pyridoxine kinase

XFF4834R

NP_641857.1 lcl|pdxY-XAC1524

1

302

S=1265 I=87 E=3.42157e-146

pyridoxine kinase

XFF4834R

NP_636848.1 lcl|pdxY-XCC1476

1

302

S=1212 I=83 E=7.39689e-140

pyridoxine kinase

pubmed

24

261

S=327 I=33 E=5.88875e-31

Pyridoxine kinase EC=2.7.1.35 ; ATP-binding Magnesium Metal-binding Nucleotide-binding Transferase Zinc

Pubmed 8764513

 

prodomImg

pubmed

24

280

S=322 I=31 E=2.01335e-30

Pyridoxine kinase EC=2.7.1.35 ; ATP-binding Magnesium Metal-binding Nucleotide-binding Transferase Zinc

Pubmed 7612925

 

prodomImg

pubmed

25

246

S=208 I=28 E=1.42875e-16

Pyridoxal kinase EC=2.7.1.35 ; Alternative splicing ATP-binding Metal-binding Nucleotide-binding phosphate Transferase Zinc

Pubmed 12244454,11910005

 

prodomImg

pubmed

25

278

S=206 I=28 E=2.13371e-16

Pyridoxal kinase

Pubmed 15499907

 

prodomImg

pubmed

24

301

S=189 I=25 E=2.42777e-14

Pyridoxamine kinase EC=2.7.1.35 ; ATP-binding Metal-binding Nucleotide-binding Transferase Zinc

Pubmed 8761466

 

prodomImg

pubmed

25

246

S=187 I=26 E=4.16841e-14

Pyridoxal kinase

Pubmed 17707212

 

prodomImg

pubmed

25

203

S=165 I=29 E=1.96446e-11

Pyridoxal kinase EC=2.7.1.35 ; Acetylation ATP-binding Cytoplasm Metal-binding Nucleotide-binding Phosphoprotein Transferase Zinc

Pubmed 10395444,12198308

 

prodomImg

pubmed

25

203

S=161 I=27 E=7.3925e-11

Putative uncharacterized protein PDXK

Pubmed 10830953

 

prodomImg

pubmed

19

203

S=160 I=29 E=7.99595e-11

Pyridoxal kinase EC=2.7.1.35 ; Acetylation ATP-binding Cytoplasm Metal-binding Nucleotide-binding Phosphoprotein Transferase Zinc

Pubmed 9924807

 

prodomImg

pubmed

25

203

S=160 I=27 E=9.43656e-11

Pyridoxal kinase EC=2.7.1.35 ; Acetylation Alternative splicing ATP-binding Cytoplasm Metal-binding Nucleotide-binding Phosphoprotein Transferase

Pubmed 9099727,15154080

 

prodomImg

sp_Pdown

sp|Q7W6K7|PDXK_BORPA

20

280

S=351 I=37 E=4.13873e-34

Pyridoxine kinase EC=2.7.1.35 ; ATP-binding Magnesium Metal-binding Nucleotide-binding Transferase Zinc

sp_Pdown

sp|Q7WII1|PDXK_BORBR

20

280

S=351 I=37 E=4.13873e-34

Pyridoxine kinase EC=2.7.1.35 ; ATP-binding Magnesium Metal-binding Nucleotide-binding Transferase Zinc

sp_Pdown

sp|Q7VYK4|PDXK_BORPE

20

280

S=342 I=36 E=5.81003e-33

Pyridoxine kinase EC=2.7.1.35 ; ATP-binding Magnesium Metal-binding Nucleotide-binding Transferase Zinc

sp_Pdown

sp|Q8XBL0|PDXK_ECO57

24

261

S=330 I=33 E=1.62414e-31

Pyridoxine kinase EC=2.7.1.35 ; ATP-binding Magnesium Metal-binding Nucleotide-binding Transferase Zinc

sp_Pdown

sp|Q3YZC3|PDXK_SHISS

24

261

S=329 I=34 E=2.07322e-31

Pyridoxine kinase EC=2.7.1.35 ; ATP-binding Magnesium Metal-binding Nucleotide-binding Transferase Zinc

Iprscan [G3DSA:3.40.1190.20]

19

301

-

Iprscan IPR013749 [PF08543]

151

274

Phosphomethylpyrimidine kinase type-1

Iprscan IPR004625 [TIGR00687]

21

302

Pyridoxal phosphate (active vitamin B6) biosynthesis, pyridoxal kinase

Iprscan [seg]

41

54

-

Iprscan [seg]

184

194

-

Iprscan [seg]

283

292

-

PD006833

27

276

S=181 I=28 E=1.68974e-14

PDA1T9P8

1

26

S=136 I=100 E=4.96058e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4ZxdlxHl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

14 hits
swiss-prot

Swiss-Prot ncbi-blastp

93 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQfHTy/XFF4834R_chr29920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQfHTy/XFF4834R_chr29920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQfHTy/XFF4834R_chr29920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByQfHTy/XFF4834R_chr29920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.