Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr42840XFF4834R_chr42840putative glycerate kinase

XFF4834R_chr42840
XFF4834R_chr_4615
XFF4834R_chr_4615
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42850
XFF4834R_chr42850
ID
AC XFF4834R_chr42840
LT XFF4834R_chr42840
OR XFF4834R_chr from 4963119 to 4964288 on strand -
DE putative glycerate kinase
IP Glycerate kinase
CL 1.7.26 Allantoin assimilation GO:0009442
EC
GO InterPro
Biological Process: organic acid phosphorylation (GO:0031388)
Molecular Function: glycerate kinase activity (GO:0008887)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 39180.4 Da
SQ 389 aa
 
........10........20........30........40........50
| | | | |
MKIIIAPDSYKESLSALEVATQIEAGFREVFPDWQYHKVPVADGGEGTVD
ALVAATGGRVIACTVSGPLGAPVQAFFGLTGDGRTAVIEMAAASGLALLP
PAERAPLRTSTAGVGELILAALDAGARRFIIGIGGSATNDGGAGLAQALG
VRLLDGQGEAIGPGGGALAALARIDTEGMDVRLQDCQFEVACDVDNPLIG
PTGASAVFGPQKGATPSMVRQLDRNLQHYADLLQRDLGVRLHALPGGGAA
GGLGAALVAYLGAQLRPGVEIVAQALGLEALVAQADLVITGEGRLDSQSL
HGKTPVGVARVAQRHAKPVIAIAGCLGNGAALLHGHGIDAMFAVVHRACT
VEQALADAASNVRIAARNVAATLQLGGALAQVRSEGERG
Show or not Domain decomposition
 
XFF4834R

NP_644654.1 lcl|glxK-XAC4360

1

389

S=1367 I=73 E=1.61429e-158

glycerate kinase

XFF4834R

YP_366203.1 lcl|glxK-XCV4472

1

389

S=1346 I=72 E=7.28319e-156

glycerate kinase

XFF4834R

NP_639560.1 lcl|glxK-XCC4226

1

369

S=1240 I=69 E=3.91338e-143

glycerate kinase

pubmed

1

369

S=825 I=48 E=3.48301e-91

Glycerate kinase EC=2.7.1.31 ; ATP-binding Nucleotide-binding Transferase

Pubmed 7584049

 

prodomImg

pubmed

1

369

S=780 I=45 E=1.12543e-85

Glycerate kinase 2 EC=2.7.1.31 ; ATP-binding Nucleotide-binding Transferase

Pubmed 1705543

 

prodomImg

pubmed

1

369

S=737 I=44 E=1.60234e-80

Glycerate kinase 1 EC=2.7.1.31 ; ATP-binding Nucleotide-binding Transferase

Pubmed 10601204

 

prodomImg

pubmed

1

369

S=736 I=42 E=2.04539e-80

Glycerate kinase

Pubmed 17240088

 

prodomImg

pubmed

1

369

S=704 I=41 E=1.88472e-76

Glycerate kinase EC=2.7.1.31 ; ATP-binding Nucleotide-binding Transferase

Pubmed 10217496

 

prodomImg

sp_Pdown

sp|P42100|GLXK_BACSU

1

369

S=825 I=48 E=2.36898e-91

Glycerate kinase EC=2.7.1.31 ; ATP-binding Nucleotide-binding Transferase

sp_Pdown

sp|P23524|GLXK2_ECOLI

1

369

S=780 I=45 E=7.65465e-86

Glycerate kinase 2 EC=2.7.1.31 ; ATP-binding Nucleotide-binding Transferase

sp_Pdown

sp|P44507|GLXK_HAEIN

1

369

S=771 I=44 E=9.76304e-85

Glycerate kinase EC=2.7.1.31 ; ATP-binding Nucleotide-binding Transferase

sp_Pdown

sp|P77364|GLXK1_ECOLI

1

369

S=737 I=44 E=1.08983e-80

Glycerate kinase 1 EC=2.7.1.31 ; ATP-binding Nucleotide-binding Transferase

sp_Pdown

sp|Q9XBL1|GLXK_BACC1

1

369

S=704 I=41 E=1.28189e-76

Glycerate kinase EC=2.7.1.31 ; ATP-binding Nucleotide-binding Transferase

Iprscan IPR018193 [G3DSA:3.90.1510.10]

42

276

Glycerate kinase, flavodoxin-like domain

Iprscan IPR004381 [PTHR21599]

2

380

Glycerate kinase

Iprscan IPR004381 [PF02595]

1

376

Glycerate kinase

Iprscan IPR004381 [TIGR00045]

2

376

Glycerate kinase

Iprscan [seg]

91

108

-

Iprscan [seg]

130

135

-

Iprscan [seg]

156

172

-

Iprscan [seg]

241

265

-

Iprscan [seg]

320

338

-

Iprscan [seg]

370

381

-

PD011710

9

360

S=769 I=47 E=9.22592e-86

PDA7N0V7

1

79

S=258 I=63 E=7.61973e-24

Iprscan IPR004381 [SSF110738]

1

378

Glycerate kinase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ojy0ZzOk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbC1RCA/XFF4834R_chr42840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbC1RCA/XFF4834R_chr42840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbC1RCA/XFF4834R_chr42840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbC1RCA/XFF4834R_chr42840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.