Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr01250aldBXFF4834R_chr01250probable Aldehyde dehydrogenase B
  2. XFF4834R_chr10680gloBXFF4834R_chr10680probable hydroxyacylglutathione hydrolase
  3. XFF4834R_chr35280gloAXFF4834R_chr35280probable glyoxalase I, Ni-dependent

aldB XFF4834R_chr01250
XFF4834R_chr01240
XFF4834R_chr01240
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0142
XFF4834R_chr_0142
ID aldB
AC XFF4834R_chr01250
LT XFF4834R_chr01250
OR XFF4834R_chr from 154590 to 156122 on strand -
DE probable Aldehyde dehydrogenase B
IP Aldehyde dehydrogenase, conserved site
CL 1.7.23 Methylglyoxal metabolism GO:0009438
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 55560.9 Da
SQ 510 aa
 
........10........20........30........40........50
| | | | |
MMNAQPATKPLNTDPQSIFKPRYDNFIGGTWVAPKGGQYFDNTTPINGKV
LTSIARSTAPDIEAALDAAHAAKNAWGKTSTTERSNILLKIADRIEQNLE
LLAYAETWDNGKPVRETLNADVPLCVDHFRYFAGAIRAQEGGISEIDSDT
IAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAAGNCVVMKPAEQTPAS
ILVLMELIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIAFTGETTTGR
LIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFN
QGEVCTCPSRALIQESIYDAFMEKALARVAAIKQGNPLDPNTMVGAQASS
EQLEKILSYIDIGKQEGAEVLIGGERNTLDGDLAEGFYVKPTVFKGHNKM
RVFQEEIFGPVVSVTTFKDEADALAIANDTLYGLGAGVWSRDASRLYRMG
RAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLV
SYSPKALGFF
XFF4834R

XFF4834R_chr07270 lcl|betB-XFF4834R_chr07270

21

500

S=820 I=41 E=1.08615e-92

betaine aldehyde dehydrogenase, NAD-dependent

XFF4834R

XFF4834R_chr08850 lcl|XFF4834R_chr09420449_1027918_r3_XFF4834R-XFF4834R_chr08850

26

501

S=569 I=35 E=2.83718e-62

XFF4834R

XFF4834R_chr24530 lcl|sad-XFF4834R_chr24530

40

501

S=454 I=30 E=2.82875e-48

predicted aldehyde dehydrogenase

XFF4834R

XFF4834R_chr31940 lcl|XFF4834R_chr34480466_3665971_r3_XFF4834R-XFF4834R_chr31940

21

502

S=389 I=28 E=2.01747e-40

XFF4834R

XFF4834R_chr37780 lcl|putA-XFF4834R_chr37780

76

481

S=368 I=32 E=7.00731e-38

fused DNA-binding transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

XFF4834R

XFF4834R_chr19380 lcl|XFF4834R_chr20740024_2218556_r2_XFF4834R-XFF4834R_chr19380

153

503

S=307 I=28 E=1.96611e-30

XFF4834R

XFF4834R_chr41130 lcl|XFF4834R_chr_4776385_4777803_r1_XFF4834R-XFF4834R_chr41130

76

466

S=271 I=27 E=3.83457e-26

XFF4834R

XFF4834R_chr25680 lcl|XFF4834R_chr28230536_2979152_r2_XFF4834R-XFF4834R_chr25680

98

322

S=129 I=29 E=7.27008e-09

XFF4834R

XFF4834R_chr12540 lcl|XFF4834R_chr13190488_1421068_f2_XFF4834R-XFF4834R_chr12540

76

322

S=116 I=27 E=2.25643e-07

XFF4834R

XFF4834R_chr07270 lcl|betB-XFF4834R_chr07270

21

500

S=820 I=41 E=1.08615e-92

betaine aldehyde dehydrogenase, NAD-dependent

XFF4834R

YP_361836.1 lcl|XCV0105

2

510

S=2579 I=95 E=0

putative aldehyde dehydrogenase

XFF4834R

NP_640485.2 lcl|aldA-XAC0129

1

510

S=2565 I=94 E=0

chloroacetaldehyde dehydrogenase

XFF4834R

NP_635496.1 lcl|aldA-XCC0101

2

510

S=2545 I=93 E=0

chloroacetaldehyde dehydrogenase

XFF4834R

lcl|XALc_2105

22

496

S=888 I=41 E=2.46887e-100

putative aldehyde dehydrogenase protein

XFF4834R

YP_362506.1 lcl|betB-XCV0775

21

500

S=823 I=41 E=2.32743e-92

betaine aldehyde dehydrogenase

XFF4834R

NP_641072.1 lcl|betB-XAC0719

21

500

S=812 I=40 E=4.17071e-91

betaine aldehyde dehydrogenase

XFF4834R

NP_638749.1 lcl|betB-XCC3403

21

500

S=808 I=41 E=1.41358e-90

betaine aldehyde dehydrogenase

XFF4834R

NP_641234.1 lcl|badH-XAC0882

26

501

S=573 I=35 E=4.59943e-62

aldehyde dehydrogenase

XFF4834R

YP_362648.1 lcl|XCV0917

26

501

S=552 I=34 E=1.42634e-59

putative aldehyde dehydrogenase

XFF4834R

lcl|XALc_3040

29

461

S=474 I=32 E=4.47485e-50

putative aldehyde dehydrogenase protein

pubmed

16

510

S=2205 I=82 E=0

Chloroacetaldehyde dehydrogenase ; Oxidoreductase Plasmid

Pubmed 9511738

 

prodomImg

pubmed

19

510

S=2148 I=80 E=0

Acetaldehyde dehydrogenase 2 EC=1.2.1.3 ; Acetoin catabolism NAD Oxidoreductase

Pubmed 1732222

 

prodomImg

pubmed

11

510

S=2129 I=78 E=0

NAD-dependent chloroacetaldehyde dehydrogenase ; Oxidoreductase

Pubmed 9511738

 

prodomImg

pubmed

9

510

S=1991 I=72 E=0

Aldehyde dehydrogenase ; Oxidoreductase

Pubmed 16944126

 

prodomImg

pubmed

19

510

S=1987 I=74 E=0

Alcohol dehydrogenase ; Oxidoreductase

Pubmed 14645271

 

prodomImg

pubmed

9

510

S=1981 I=72 E=0

Putative aldehyde dehydrogense ; Oxidoreductase

Pubmed 17675378

 

prodomImg

pubmed

19

510

S=1970 I=73 E=0

Aldehyde dehydrogenase 1 ; Oxidoreductase

Pubmed 10919810

 

prodomImg

pubmed

9

510

S=1967 I=72 E=0

EPTC-inducible aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

Pubmed 7836301

 

prodomImg

pubmed

19

510

S=1903 I=71 E=0

NAD+ dependent acetaldehyde dehydrogenase ; Oxidoreductase

Pubmed 10075429

 

prodomImg

pubmed

19

510

S=1895 I=70 E=0

Aldehyde dehydrogenase B EC=1.2.1.- ; Magnesium NADP Oxidoreductase

Pubmed 7768815,8041620

 

prodomImg

sp_Pdown

sp|P46368|DHA2_RALEH

19

510

S=2148 I=80 E=0

Acetaldehyde dehydrogenase 2 EC=1.2.1.3 ; Acetoin catabolism NAD Oxidoreductase

sp_Pdown

sp|Q9RYG9|ALDH_DEIRA

19

510

S=2129 I=79 E=0

Aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

sp_Pdown

sp|Q9ZA11|ALDH_RHORT

1

510

S=2016 I=73 E=0

Aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

sp_Pdown

sp|Q9RJZ6|ALDH_STRCO

19

510

S=1996 I=73 E=0

Probable aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

sp_Pdown

sp|P46369|THCA_RHOER

9

510

S=1967 I=72 E=0

EPTC-inducible aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

PDA1S1O4

110

425

S=255 I=31 E=2.34864e-23

PDA1I787

267

319

S=246 I=79 E=3.56621e-22

PDA1F8I6

107

152

S=222 I=83 E=3.01422e-19

PD576555

157

504

S=214 I=25 E=2.21965e-18

PDA9F7Z1

212

498

S=161 I=26 E=6.62534e-12

PDA5V4J9

463

510

S=148 I=60 E=2.49112e-10

PDA1F9I7

76

106

S=148 I=94 E=2.53494e-10

PD250846

212

266

S=146 I=57 E=4.83246e-10

PDA6A8W1

153

175

S=139 I=100 E=2.62271e-09

PDA0J2C9

424

461

S=139 I=63 E=3.43663e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 7igFXw53)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

9 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr01250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr01250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr01250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr01250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
gloB XFF4834R_chr10680
XFF4834R_chr10670
XFF4834R_chr10670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10690
XFF4834R_chr10690
ID gloB
AC XFF4834R_chr10680
LT XFF4834R_chr10680
OR XFF4834R_chr from 1208648 to 1209415 on strand -
DE probable hydroxyacylglutathione hydrolase
IP Beta-lactamase-like
CL 1.7.23 Methylglyoxal metabolism GO:0009438
EC
GO InterPro
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: hydroxyacylglutathione hydrolase activity (GO:0004416)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100505)
MW 27818.3 Da
SQ 255 aa
 
........10........20........30........40........50
| | | | |
MRLIALPAFDDNYIWALIAADGRAIIVDPGQAEPVLAAAQRQGLVPSAVL
LTHHHGDHIGGVAELQQRWPDLELFGPADERIPANAHQVGHGERLRLLDV
EFQVLEVPGHTRSHIAFVAAGHLFSGDTLFSLGCGRMFEGTAPQMFDSLQ
RLASLPGETLVCCGHEYTLANAAFALHVDPTNAALQRRQQEAQAMRHAAR
PTLPISLKSELATNPFLRTSRPEIRAAVAPRAAGALSSEVDVFAELRRWK
DEFRA
Hamap GLO2_MF_01374 raw_score=5792 norm_score=43.515

Hydroxyacylglutathione hydrolase [gloB].

XFF4834R

XFF4834R_chr12930 lcl|XFF4834R_chr13640840_1472664_r1_XFF4834R-XFF4834R_chr12930

26

175

S=159 I=33 E=6.29181e-13

XFF4834R

YP_362818.1 lcl|gloB-XCV1087

1

255

S=1137 I=86 E=7.82203e-131

hydroxyacylglutathione hydrolase

XFF4834R

NP_641426.1 lcl|gloB-XAC1087

1

255

S=1121 I=85 E=6.9722e-129

hydroxyacylglutathione hydrolase

XFF4834R

NP_636363.1 lcl|gloB-XCC0985

1

255

S=956 I=71 E=6.91676e-109

hydroxyacylglutathione hydrolase

XFF4834R

lcl|gloB-XALc_0596

1

255

S=799 I=61 E=7.42809e-90

probable hydroxyacylglutathione hydrolase (glyoxalase II) protein

XFF4834R

YP_365205.1 lcl|XCV3474

26

167

S=164 I=34 E=6.90501e-13

putative metallo-beta-lactamase superfamily protein

XFF4834R

NP_643664.1 lcl|XAC3357-XAC3357

26

175

S=161 I=33 E=1.29358e-12

beta-lactamase

XFF4834R

NP_638543.1 lcl|XCC3197

19

175

S=157 I=33 E=4.12475e-12

beta-lactamase

XFF4834R

lcl|XALc_2310

30

176

S=136 I=32 E=1.4835e-09

putative metallo-beta-lactamase protein

XFF4834R

YP_364176.1 lcl|XCV2445

105

173

S=121 I=45 E=1.04497e-07

putative metallo-beta-lactamase superfamily protein

pubmed

1

253

S=530 I=44 E=1.02856e-55

Hydroxyacylglutathione hydrolase EC=3.1.2.6 ; Metal-binding Zinc

Pubmed 17764159

 

prodomImg

pubmed

1

253

S=497 I=42 E=9.39538e-52

GloB ; Hydrolase Metal-binding Zinc

Pubmed 11286884,12564983

 

prodomImg

pubmed

1

253

S=483 I=35 E=5.09487e-50

Hydroxyacylglutathione hydrolase EC=3.1.2.6 ; Metal-binding Zinc

Pubmed 7507875

 

prodomImg

pubmed

1

255

S=461 I=38 E=2.53003e-47

Hydroxyacylglutathione hydrolase cytoplasmic EC=3.1.2.6 ; Iron Manganese Metal-binding Zinc

Pubmed 9349270,9065762

 

prodomImg

pubmed

6

253

S=445 I=38 E=1.86154e-45

Glyoxalase II

Pubmed 16153601

 

prodomImg

pubmed

6

253

S=444 I=38 E=2.66145e-45

Glyoxalase II

Pubmed 14638937

 

prodomImg

pubmed

1

254

S=408 I=35 E=6.45493e-41

Hydroxyacylglutathione hydrolase EC=3.1.2.6 ; Metal-binding Zinc

Pubmed 9434774

 

prodomImg

pubmed

1

253

S=407 I=39 E=7.6179e-41

Hydroxyacylglutathione hydrolase EC=3.1.2.6 ; Metal-binding Zinc

Pubmed 6209404

 

prodomImg

pubmed

1

253

S=406 I=35 E=1.01576e-40

Hydroxyacylglutathione hydrolase 1, mitochondrial EC=3.1.2.6 ; Alternative splicing Iron Manganese Metal-binding Mitochondrion Transit peptid

Pubmed 9349270

 

prodomImg

pubmed

1

254

S=400 I=35 E=5.91104e-40

Hydroxyacylglutathione hydrolase EC=3.1.2.6 ; Metal-binding Zinc

Pubmed 8550579,11157797

 

prodomImg

sp_Pdown

sp|Q3BWP5|GLO2_XANC5

1

255

S=1137 I=86 E=1.97028e-129

Hydroxyacylglutathione hydrolase EC=3.1.2.6 ; Metal-binding Zinc

Iprscan [G3DSA:3.60.15.10]

1

253

-

Iprscan IPR017782 [MF_01374]

1

253

Hydroxyacylglutathione hydrolase

Iprscan [PF00753]

11

165

-

Iprscan IPR001279 [SM00849]

11

165

Beta-lactamase-like

Iprscan IPR017782 [TIGR03413]

3

253

Hydroxyacylglutathione hydrolase

Iprscan [seg]

183

200

-

Iprscan [seg]

226

235

-

PD000482

9

251

S=404 I=40 E=1.84157e-41

PD759591

3

81

S=200 I=39 E=9.2164e-17

PD929655

1

46

S=121 I=50 E=3.88917e-07

PD390495

16

150

S=120 I=30 E=4.06246e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XJeBbl5o)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

36 hits
swiss-prot

Swiss-Prot ncbi-blastp

280 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr10680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr10680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr10680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr10680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
gloA XFF4834R_chr35280
XFF4834R_chr_3750
XFF4834R_chr_3750
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35290
XFF4834R_chr35290
ID gloA
AC XFF4834R_chr35280
LT XFF4834R_chr35280
OR XFF4834R_chr from 4098008 to 4098532 on strand +
DE probable glyoxalase I, Ni-dependent
IP Glyoxalase/bleomycin resistance protein/dioxygenase; Glyoxalase I; Glyoxalase I, conserved site
CL 1.7.23 Methylglyoxal metabolism GO:0009438
EC
GO InterPro
Molecular Function: lactoylglutathione lyase activity (GO:0004462)
Molecular Function: metal ion binding (GO:0046872)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL:
CC STATUS: curated by darrasse (20120326)
MW 19316.6 Da
SQ 174 aa
 
........10........20........30........40........50
| | | | |
MPLNDLQHVPGASAAPAETHGFVFNHTMLRVKDATQSLDFYTRVLGFRLL
DARDFADAGFSLYFLALLLEGTAIPDDDAQRRLWMAGIPGVLELTHNHGT
ETQDGPVYHDGNSDPRGFGHLCISVPDIHAACARFDSLNVPYQKRLEDGR
MKHLAFIKDPDGYWVEIISNTPLA
XFF4834R

NP_643939.1 lcl|gloA-XAC3632

1

174

S=902 I=98 E=1.44581e-102

lactoylglutathione lyase

XFF4834R

YP_365480.1 lcl|gloA-XCV3749

1

174

S=901 I=97 E=1.7063e-102

lactoylglutathione lyase

XFF4834R

NP_635967.1 lcl|gloA-XCC0575

1

174

S=855 I=92 E=7.09953e-97

lactoylglutathione lyase

XFF4834R

lcl|gloA-XALc_0775

26

170

S=108 I=28 E=1.90784e-06

probable lactoylglutathione lyase protein

pubmed

1

173

S=620 I=68 E=6.09429e-67

Lactoylglutathione lyase EC=4.4.1.5 ; Metal-binding Zinc

Pubmed 7959071

 

prodomImg

pubmed

3

174

S=436 I=49 E=1.19146e-44

Lactoylglutathione lyase EC=4.4.1.5 ; Metal-binding Polymorphism Zinc

Pubmed 7684374,8449929

 

prodomImg

pubmed

10

168

S=404 I=49 E=1.01501e-40

Lactoylglutathione lyase EC=4.4.1.5 ; Metal-binding Stress response Zinc

Pubmed 8616220

 

prodomImg

pubmed

2

168

S=401 I=47 E=2.51343e-40

Glyoxalase I EC=4.4.1.5 ; Lyase

Pubmed 10666306

 

prodomImg

pubmed

13

173

S=383 I=47 E=3.34577e-38

Glyoxylase I EC=4.4.1.5 ; Lyase

Pubmed 15205912

 

prodomImg

pubmed

22

173

S=337 I=45 E=1.26479e-32

Glyoxylase I EC=4.4.1.5 ; Lyase

Pubmed 15205912

 

prodomImg

pubmed

1

174

S=380 I=47 E=9.19879e-38

Glyoxalase I

Pubmed 17110973

 

prodomImg

pubmed

14

174

S=312 I=41 E=1.46319e-29

Glyoxalase I

Pubmed 17110973

 

prodomImg

pubmed

14

171

S=374 I=45 E=4.04983e-37

Lactoylglutathione lyase EC=4.4.1.5 ; Cobalt Manganese Metal-binding Nickel Repeat Zinc

Pubmed 15042280

 

prodomImg

pubmed

6

169

S=363 I=45 E=8.05763e-36

Lactoylglutathione lyase EC=4.4.1.5 ; Cobalt Manganese Metal-binding Nickel Repeat Zinc

Pubmed 15042280

 

prodomImg

sp_Pdown

sp|P16635|LGUL_PSEPU

1

173

S=620 I=68 E=4.23741e-67

Lactoylglutathione lyase EC=4.4.1.5 ; Metal-binding Zinc

sp_Pdown

sp|Q9HU72|LGUL_PSEAE

10

169

S=456 I=57 E=3.56197e-47

Lactoylglutathione lyase EC=4.4.1.5 ; Metal-binding Zinc

sp_Pdown

sp|Q4R5F2|LGUL_MACFA

3

174

S=448 I=51 E=3.43701e-46

Lactoylglutathione lyase EC=4.4.1.5 ; Metal-binding Zinc

sp_Pdown

sp|Q6P7Q4|LGUL_RAT

3

174

S=442 I=49 E=1.58059e-45

Lactoylglutathione lyase EC=4.4.1.5 ; Metal-binding Zinc

sp_Pdown

sp|Q9CPU0|LGUL_MOUSE

19

174

S=441 I=53 E=2.10753e-45

Lactoylglutathione lyase EC=4.4.1.5 ; Metal-binding Zinc

Iprscan [G3DSA:3.10.180.10]

1

171

-

Iprscan IPR004360 [PF00903]

23

167

Glyoxalase/bleomycin resistance protein/dioxygenase

Iprscan IPR004361 [TIGR00068]

19

172

Glyoxalase I

Iprscan IPR018146 [PS00934]

26

47

Glyoxalase I, conserved site

PD770265

51

112

S=170 I=55 E=4.01178e-13

PD967830

113

168

S=160 I=49 E=6.53158e-12

PDA2D709

17

146

S=155 I=34 E=2.75291e-11

PDA791Z7

1

23

S=111 I=91 E=5.31805e-06

PD967829

8

115

S=111 I=26 E=5.95631e-06

PDA791Z8

1

23

S=109 I=91 E=8.818e-06

PDA79209

1

23

S=107 I=91 E=1.83416e-05

PDA2U3B4

1

23

S=101 I=83 E=8.65833e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wCBWrFhc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

19 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr35280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr35280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr35280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByDeyGM/XFF4834R_chr35280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.