Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr08100sahHXFF4834R_chr08100putative S-adenosyl-L-homocysteine hydrolase
  2. XFF4834R_chr08190metKXFF4834R_chr08190probable S-adenosylmethionine synthetase

sahH XFF4834R_chr08100
XFF4834R_chr08090
XFF4834R_chr08090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08110
XFF4834R_chr08110
ID sahH
AC XFF4834R_chr08100
LT XFF4834R_chr08100
OR XFF4834R_chr from 935918 to 937360 on strand -
DE putative S-adenosyl-L-homocysteine hydrolase
IP S-adenosyl-L-homocysteine hydrolase; S-adenosyl-L-homocysteine hydrolase, NAD binding; S-adenosyl-L-homocysteine hydrolase, conserved site
CL 1.7.20 S-adenosyl methionine biosynthesis GO:0006556
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: one-carbon metabolic process (GO:0006730)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: adenosylhomocysteinase activity (GO:0004013)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 52798.8 Da
SQ 480 aa
 
........10........20........30........40........50
| | | | |
MNAVTKITPHTDYKIADISLADWGRKELDIAEHEMPGLMSIRRKHAQTKP
LKDVRITGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIAA
TGTPVFAWKGETLEEYWDCTLDALTFTLPDGTLTGPELVVDDGGDVTLLI
HKGYELENGSTWVDEPASSHEEGVIKALLKRVAVERPGYWGRVVKDWKGV
SEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKFDNLYGCRESLADGL
KRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGARVIVTEIDPICALQAS
MEGFEVNTIESTLGRADIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFD
NEIQVDALKALKDVQKINIKPQVDKYVFPNGNAIFLLADGRLVNLGCATG
HPSFVMSNSFANQTLAQIDLWEKRDTYEKKVYILPKHLDEEVARLHLEKI
GVKLTTLTKDQADYLGVDVAGPYKPDHYRY
Hamap SAHH_MF_00563_B raw_score=14441 norm_score=53.905

Adenosylhomocysteinase [ahcY].

X.species

NP_641156.1 lcl|sahH-XAC0804

1

480

S=2523 I=99 E=0

S-adenosyl-L-homocysteine hydrolase

X.species

YP_362587.1 lcl|sahH-XCV0856

1

480

S=2498 I=98 E=0

S-adenosyl-L-homocysteine hydrolase

X.species

NP_636143.1 lcl|sahH-XCC0752

1

480

S=2460 I=96 E=0

S-adenosyl-L-homocysteine hydrolase

X.species

lcl|XALc_2790

1

480

S=2236 I=87 E=0

putative adenosylhomocysteinase protein

pubmed

4

480

S=1547 I=61 E=1.38416e-178

Adenosylhomocysteinase EC=3.3.1.1 ; Hydrolase NAD One-carbon metabolism

Pubmed 17981978

 

prodomImg

pubmed

12

480

S=1533 I=64 E=7.70488e-177

Adenosylhomocysteinase EC=3.3.1.1 ; Cytoplasm Hydrolase NAD One-carbon metabolism

Pubmed 12501384

 

prodomImg

pubmed

11

480

S=1525 I=62 E=6.52318e-176

Adenosylhomocysteinase EC=3.3.1.1 ; Cytoplasm Hydrolase NAD One-carbon metabolism

Pubmed 12446651

 

prodomImg

pubmed

9

480

S=1525 I=60 E=6.99442e-176

Adenosylhomocysteinase EC=3.3.1.1 ; Hydrolase NAD One-carbon metabolism

Pubmed 16720268

 

prodomImg

pubmed

12

480

S=1514 I=64 E=1.59995e-174

Adenosylhomocysteinase EC=3.3.1.1 ; Cytoplasm Hydrolase NAD One-carbon metabolism

Pubmed 1631127,8282711

 

prodomImg

pubmed

4

480

S=1512 I=61 E=2.2676e-174

Adenosylhomocysteinase EC=3.3.1.1 ; Hydrolase NAD One-carbon metabolism Stress response

Pubmed 8165255

 

prodomImg

pubmed

12

480

S=1510 I=60 E=4.6757e-174

Adenosylhomocysteinase EC=3.3.1.1 ; Hydrolase NAD One-carbon metabolism

Pubmed 17103476

 

prodomImg

pubmed

3

480

S=1506 I=61 E=1.13781e-173

Adenosylhomocysteinase EC=3.3.1.1 ; Hydrolase NAD One-carbon metabolism

Pubmed 14750518

 

prodomImg

pubmed

3

480

S=1499 I=60 E=9.80251e-173

Adenosylhomocysteinase EC=3.3.1.1 ; Hydrolase NAD One-carbon metabolism

Pubmed 1374911

 

prodomImg

pubmed

4

480

S=1496 I=61 E=1.95196e-172

Adenosylhomocysteinase EC=3.3.1.1 ; Hydrolase NAD One-carbon metabolism

Pubmed 7872785

 

prodomImg

sp

1

480

S=2523 I=99 E=0

Adenosylhomocysteinase EC=3.3.1.1 ; Cytoplasm Hydrolase NAD One-carbon metabolism

 

prodomImg

sp

1

480

S=2498 I=98 E=0

Adenosylhomocysteinase EC=3.3.1.1 ; Cytoplasm Hydrolase NAD One-carbon metabolism

 

prodomImg

sp

1

480

S=2491 I=97 E=0

Adenosylhomocysteinase EC=3.3.1.1 ; Cytoplasm Hydrolase NAD One-carbon metabolism

 

prodomImg

sp

1

480

S=2491 I=97 E=0

Adenosylhomocysteinase EC=3.3.1.1 ; Cytoplasm Hydrolase NAD One-carbon metabolism

 

prodomImg

sp

1

480

S=2460 I=96 E=0

Adenosylhomocysteinase EC=3.3.1.1 ; Cytoplasm Hydrolase NAD One-carbon metabolism

 

prodomImg

Iprscan [G3DSA:3.40.50.1480]

8

480

-

Iprscan IPR000043 [PIRSF001109]

1

472

S-adenosyl-L-homocysteine hydrolase

Iprscan IPR000043 [PTHR23420]

8

480

S-adenosyl-L-homocysteine hydrolase

Iprscan IPR000043 [PF05221]

11

479

S-adenosyl-L-homocysteine hydrolase

Iprscan IPR015878 [PF00670]

238

400

S-adenosyl-L-homocysteine hydrolase, NAD binding

Iprscan IPR000043 [TIGR00936]

13

472

S-adenosyl-L-homocysteine hydrolase

Iprscan IPR020082 [PS00739]

260

277

S-adenosyl-L-homocysteine hydrolase, conserved site

Iprscan IPR020082 [PS00738]

84

98

S-adenosyl-L-homocysteine hydrolase, conserved site

PD001319

16

236

S=527 I=57 E=2.91622e-56

PD551162

237

329

S=373 I=76 E=1.10005e-37

PD002566

401

480

S=329 I=72 E=2.4432e-32

PDA8E2E9

203

236

S=136 I=76 E=5.88338e-09

PD570452

332

374

S=136 I=67 E=7.00417e-09

PD266584

401

465

S=132 I=45 E=2.13811e-08

PDA1K9O2

177

202

S=122 I=85 E=3.30364e-07

PDA3H9F6

192

350

S=120 I=27 E=6.29787e-07

PDA39516

331

400

S=115 I=37 E=2.39072e-06

PDA9J2X5

222

416

S=113 I=26 E=3.60159e-06

Iprscan IPR016040 [SSF51735]

228

427

NAD(P)-binding domain

Iprscan [SSF52283]

8

480

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ZNkzJOrt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

101 hits
swiss-prot

Swiss-Prot ncbi-blastp

304 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiMeDsC/XFF4834R_chr08100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiMeDsC/XFF4834R_chr08100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiMeDsC/XFF4834R_chr08100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiMeDsC/XFF4834R_chr08100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
metK XFF4834R_chr08190
XFF4834R_chr08180
XFF4834R_chr08180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4628
XFF4834R_chr_4628
ID metK
AC XFF4834R_chr08190
LT XFF4834R_chr08190
OR XFF4834R_chr from 953660 to 954871 on strand -
DE probable S-adenosylmethionine synthetase
IP S-adenosylmethionine synthetase
CL 1.7.20 S-adenosyl methionine biosynthesis GO:0006556
EC
GO InterPro
Biological Process: one-carbon metabolic process (GO:0006730)
Molecular Function: methionine adenosyltransferase activity (GO:0004478)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 43676.2 Da
SQ 403 aa
 
........10........20........30........40........50
| | | | |
MSSYLFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGV
AIVAGEVTTSAWIDLEALTRKVILDIGYNSSEVGFDGETCGVLNLIGKQS
PDINQGVDRKNPEQQGAGDQGLMFGYATNETDSFMPAAIHLSHRLVEQQA
KIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKD
LIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKII
VDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQ
VSYAIGVAEPTSISVTTFGTGKIADEQIEKLIRKHFDLRPFGIIQMLDLI
HPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRADALRAAA
KLK
X.species

YP_362596.1 lcl|metK-XCV0865

1

390

S=2080 I=100 E=0

S-adenosylmethionine synthetase

X.species

NP_641165.1 lcl|metK-XAC0813

1

390

S=2080 I=100 E=0

S-adenosylmethionine synthetase

X.species

NP_636152.1 lcl|metK-XCC0761

1

390

S=2065 I=99 E=0

S-adenosylmethionine synthetase

X.species

lcl|metK-XALc_2787

1

390

S=1962 I=93 E=0

probable methionine adenosyltransferase protein

pubmed

1

374

S=1475 I=72 E=6.6652e-170

S-adenosylmethionine synthetase EC=2.5.1.6 ; Acetylation ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabo

Pubmed 6094561,8231813

 

prodomImg

pubmed

1

365

S=1350 I=69 E=8.18532e-155

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Tra

Pubmed 12674481

 

prodomImg

pubmed

1

372

S=1317 I=64 E=7.47687e-151

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potass

Pubmed 10486973

 

prodomImg

pubmed

1

372

S=1306 I=64 E=2.00093e-149

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potas

Pubmed 10486973

 

prodomImg

pubmed

3

372

S=1286 I=66 E=5.44446e-147

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Tra

Pubmed 19077236

 

prodomImg

pubmed

4

372

S=1217 I=67 E=1.17504e-138

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Transferase

Pubmed 15305924

 

prodomImg

pubmed

5

372

S=1164 I=58 E=2.60756e-132

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Transferase

Pubmed 12446909

 

prodomImg

pubmed

5

372

S=1158 I=57 E=1.53072e-131

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassi

Pubmed 8755891,9387221

 

prodomImg

pubmed

5

372

S=1152 I=60 E=8.83045e-131

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Tra

Pubmed 18192381

 

prodomImg

pubmed

5

372

S=1143 I=59 E=1.00558e-129

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Tra

Pubmed 18192393

 

prodomImg

sp

1

390

S=2080 I=100 E=0

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Tra

 

prodomImg

sp

1

390

S=2080 I=100 E=0

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Tra

 

prodomImg

sp

1

390

S=2080 I=100 E=0

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Transferase

 

prodomImg

sp

1

390

S=2080 I=100 E=0

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Tra

 

prodomImg

sp

1

390

S=2080 I=100 E=0

S-adenosylmethionine synthetase EC=2.5.1.6 ; ATP-binding Cobalt Cytoplasm Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Tra

 

prodomImg

Iprscan [G3DSA:3.30.300.10]

2

113

-

Iprscan [G3DSA:3.30.300.10]

128

235

-

Iprscan [G3DSA:3.30.300.10]

246

403

-

Iprscan IPR002133 [PIRSF000497]

1

402

S-adenosylmethionine synthetase

Iprscan IPR002133 [PTHR11964]

1

399

S-adenosylmethionine synthetase

Iprscan IPR002133 [PF02773]

235

367

S-adenosylmethionine synthetase

Iprscan IPR002133 [PF02772]

113

233

S-adenosylmethionine synthetase

Iprscan IPR002133 [PF00438]

3

101

S-adenosylmethionine synthetase

Iprscan IPR002133 [TIGR01034]

5

400

S-adenosylmethionine synthetase

Iprscan [seg]

391

403

-

PD223485

263

328

S=301 I=86 E=5.40414e-29

PD001322

203

262

S=252 I=75 E=4.63639e-23

PD606972

88

159

S=208 I=57 E=1.07562e-17

PD499406

1

48

S=204 I=84 E=2.71036e-17

PDA1L1O7

202

230

S=159 I=93 E=7.68413e-12

PD895098

160

211

S=151 I=61 E=7.74495e-11

PDA1F6O5

43

86

S=130 I=55 E=2.85936e-08

PD894188

331

363

S=128 I=64 E=5.1282e-08

PD691077

364

389

S=116 I=73 E=1.5371e-06

PDA914O7

5

207

S=114 I=26 E=2.57102e-06

Iprscan IPR002133 [SSF55973]

235

403

S-adenosylmethionine synthetase

Iprscan IPR002133 [SSF55973]

109

234

S-adenosylmethionine synthetase

Iprscan IPR002133 [SSF55973]

2

103

S-adenosylmethionine synthetase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hpkZPBaC)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

157 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiMeDsC/XFF4834R_chr08190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiMeDsC/XFF4834R_chr08190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiMeDsC/XFF4834R_chr08190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiMeDsC/XFF4834R_chr08190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.