Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr28880sufAXFF4834R_chr28880putative Fe-S cluster assembly protein

sufA XFF4834R_chr28880
XFF4834R_chr28870
XFF4834R_chr28870
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28890
XFF4834R_chr28890
ID sufA
AC XFF4834R_chr28880
LT XFF4834R_chr28880
OR XFF4834R_chr from 3329467 to 3329805 on strand -
DE putative Fe-S cluster assembly protein
IP FeS cluster biogenesis; FeS cluster insertion, C-terminal, conserved site
CL 1.7.19 Incorporation of metal ions
EC
GO InterPro
Biological Process: iron-sulfur cluster assembly (GO:0016226)
Molecular Function: structural molecule activity (GO:0005198)
Molecular Function: iron-sulfur cluster binding (GO:0051536)

Curated
PM
AN pas de modif annotation automatique car sufA (gene chez coli) donne un score aussi bon que iscA et on sait par interpro que cela concerne bien Fe-S
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20101112)
MW 11919.2 Da
SQ 112 aa
 
........10........20........30........40........50
| | | | |
MAVSLTPAALERVQRFVQQTPGALGLRFGVTKTGCSGWGHVTDLAREARD
DDAVFEQGGVRIFVDPASLPLVDGTCIDFGKHGLSETFTFSNPNATAECG
CGESFTTADEHR
XFF4834R

XFF4834R_chr04970 lcl|erpA-XFF4834R_chr04970

3

107

S=152 I=32 E=1.43108e-12

conserved protein

XFF4834R

YP_363391.1 lcl|XCV1660

1

112

S=586 I=100 E=1.27543e-64

putative iron-sulfur cluster assembly accessory protein

XFF4834R

NP_641951.1 lcl|XAC1619-XAC1619

1

112

S=576 I=98 E=2.09472e-63

hypothetical protein

XFF4834R

NP_636933.1 lcl|XCC1562

1

112

S=553 I=93 E=1.19592e-60

hypothetical protein

XFF4834R

lcl|XALc_1737

1

111

S=454 I=78 E=1.02089e-48

putative iron-sulfur cluster assembly protein (hesb/yadr/yfhf family)

XFF4834R

NP_635880.1 lcl|XCC0488

3

107

S=153 I=32 E=3.82676e-12

iron-sulfur cluster insertion protein ErpA

XFF4834R

NP_640852.1 lcl|XAC0499-XAC0499

3

107

S=152 I=32 E=4.80043e-12

iron-sulfur cluster insertion protein ErpA

XFF4834R

YP_362265.1 lcl|XCV0534

3

107

S=152 I=32 E=4.9708e-12

iron-sulfur cluster insertion protein ErpA

XFF4834R

lcl|XALc_0301

3

107

S=148 I=33 E=1.25255e-11

hypothetical iron-sulfur cluster assembly accessory protein

pubmed

1

105

S=270 I=47 E=6.33196e-25

Iron-binding protein iscA ; Metal-binding

Pubmed 12775707

 

prodomImg

pubmed

1

106

S=259 I=46 E=1.19561e-23

IscA

Pubmed 9582371

 

prodomImg

pubmed

1

107

S=255 I=46 E=3.84576e-23

HesB family protein

Pubmed 17323064

 

prodomImg

pubmed

1

105

S=255 I=47 E=4.0523e-23

Iron-binding protein iscA ; Metal-binding

Pubmed 8300516

 

prodomImg

pubmed

1

109

S=240 I=45 E=2.61608e-21

Fe-S cluster biosynthesis, putative nitrogen fixation related protein HesB protein

Pubmed 18226230

 

prodomImg

pubmed

1

109

S=238 I=42 E=4.45274e-21

Protein hesB ; Nitrogen fixation

Pubmed 8106314

 

prodomImg

pubmed

1

109

S=227 I=39 E=1.00971e-19

HesB protein

Pubmed 19008448

 

prodomImg

pubmed

1

109

S=215 I=40 E=2.92272e-18

Iron-sulfur cluster assembly accessory protein HesB

Pubmed 10217509

 

prodomImg

pubmed

1

109

S=210 I=41 E=1.1192e-17

Protein hesB, heterocyst ; Nitrogen fixation

Pubmed 8709854

 

prodomImg

pubmed

1

109

S=210 I=41 E=1.21056e-17

Protein hesB ; Nitrogen fixation

Pubmed 2115111

 

prodomImg

sp_Pdown

sp|A8GHY1|ISCA_SERP5

1

107

S=288 I=47 E=3.10656e-27

Iron-binding protein iscA ; Metal-binding

sp_Pdown

sp|A1JKQ4|ISCA_YERE8

1

107

S=285 I=46 E=7.05036e-27

Iron-binding protein iscA ; Metal-binding

Iprscan IPR000361 [G3DSA:2.60.300.12]

1

93

FeS cluster biogenesis

Iprscan IPR000361 [PTHR10072]

2

109

FeS cluster biogenesis

Iprscan [PTHR10072:SF27]

2

109

-

Iprscan [PTHR10072:SF27]

2

109

-

Iprscan IPR000361 [PF01521]

3

93

FeS cluster biogenesis

Iprscan IPR016092 [TIGR00049]

3

107

FeS cluster insertion

Iprscan IPR017870 [PS01152]

88

105

FeS cluster insertion, C-terminal, conserved site

PD983131

28

105

S=132 I=33 E=1.61489e-08

PD002183

56

92

S=105 I=58 E=3.12484e-05

Iprscan IPR000361 [SSF89360]

1

97

FeS cluster biogenesis

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one s8undmoH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

45 hits
swiss-prot

Swiss-Prot ncbi-blastp

332 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdySsDQ/XFF4834R_chr28880.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdySsDQ/XFF4834R_chr28880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdySsDQ/XFF4834R_chr28880.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdySsDQ/XFF4834R_chr28880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.