Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr07260betAXFF4834R_chr07260choline dehydrogenase
  2. XFF4834R_chr07270betBXFF4834R_chr07270Probable betaine aldehyde dehydrogenase

betA XFF4834R_chr07260
XFF4834R_chr07250
XFF4834R_chr07250
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07270
XFF4834R_chr07270
ID betA
AC XFF4834R_chr07260
LT XFF4834R_chr07260
OR XFF4834R_chr from 839215 to 840885 on strand -
DE choline dehydrogenase
IP Glucose-methanol-choline oxidoreductase, N-terminal; Glucose-methanol-choline oxidoreductase, C-terminal
CL 1.7.18 Betaine biosynthesis GO:0006578
EC
GO InterPro
Biological Process: glycine betaine biosynthetic process from choline (GO:0019285)
Biological Process: alcohol metabolic process (GO:0006066)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: choline dehydrogenase activity (GO:0008812)
Molecular Function: FAD binding (GO:0050660)
acting on CH-OH group of donors (GO:0016614)

Curated
PM
AN Adaptation to stress : Osmotic pressure
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 61505.6 Da
SQ 556 aa
 
........10........20........30........40........50
| | | | |
MQREYDYIIIGAGSAGNVLAARLTEDPGVTVLLLEAGGPDYRLDFRTQMP
AALAFPLQGRRYNWAYETEPEPYMDNRRMECGRGKGLGGSSLINGMCYIR
GNALDFDHWAKRPGLEDWSYRDVLPYFRKAETRDIGANDYHGGDGPVSVA
TPKNDNNVLFHAMVEAGVQAGYPRTDDLNGYQQEGFGPMDRTVTPRGRRA
STARGYLDMAKPRDGLHIVTHATTDRILFAGKRAIGVHYLVGHSSEGIDA
HARREVLVCAGAIASPQLLQRSGVGAPDLLRALDVQLVHDLPGVGQNLQD
HLEVYIQYACTKPVSLYPALQWWNQPAIGAQWLFAGTGTGASNQFEAGGF
IRTREEFDWPNIQYHFLPVAINYNGSNAVKEHGFQAHVGSMRTPSRGRVH
ARSRDPRQHPSILFNYQSTDQDWQEFRDAIRITREIIAQPALDAYRGREI
SPSADCKTDAELDAFVRSRAETAYHPSCSCAMGTDDMAVVDGQGRVHGME
GLRVIDASIMPRIITGNLNATTIMIAEKIADRMRGRAPLPRSTADYYIAG
DAPARR
XFF4834R

YP_362505.1 lcl|beta-XCV0774

1

555

S=2938 I=99 E=0

choline dehydrogenase

XFF4834R

NP_641071.1 lcl|betA-XAC0718

1

555

S=2932 I=99 E=0

choline dehydrogenase

XFF4834R

NP_638750.1 lcl|betA-XCC3404

1

556

S=2901 I=97 E=0

choline dehydrogenase

XFF4834R

lcl|betA-XALc_2199

5

541

S=1046 I=46 E=2.15634e-119

putative choline dehydrogenase protein

XFF4834R

YP_363880.1 lcl|XCV2149

1

534

S=707 I=36 E=2.65993e-78

choline dehydrogenase

pubmed

4

555

S=2354 I=78 E=0

Choline dehydrogenase EC=1.1.99.1 ; Cell membrane FAD Flavoprotein Oxidoreductase Stress response

Pubmed 1956285,1879697

 

prodomImg

pubmed

4

556

S=2212 I=72 E=0

Choline dehydrogenase EC=1.1.99.1 ; FAD Flavoprotein Oxidoreductase

Pubmed 10708384

 

prodomImg

pubmed

1

550

S=1360 I=47 E=7.18781e-156

Choline dehydrogenase EC=1.1.99.1 ; FAD Flavoprotein Oxidoreductase

Pubmed 10094709

 

prodomImg

pubmed

1

554

S=1348 I=48 E=2.47695e-154

Choline dehydrogenase EC=1.1.99.1 ; FAD Flavoprotein Oxidoreductase

Pubmed 18661182

 

prodomImg

pubmed

4

535

S=1331 I=50 E=2.38807e-152

Choline dehydrogenase ; Flavoprotein

Pubmed 12951056

 

prodomImg

pubmed

6

548

S=1287 I=49 E=4.86101e-147

Choline dehydrogenase EC=1.1.99.1 ; Cell membrane FAD Flavoprotein Oxidoreductase

Pubmed 9141699

 

prodomImg

pubmed

1

530

S=1009 I=43 E=2.29148e-113

Alcohol dehydrogenase ; Flavoprotein

Pubmed 16195793

 

prodomImg

pubmed

4

531

S=982 I=43 E=4.20807e-110

Probable dehydrogenase 4-pyridoxic acid dehydrogenase

Pubmed 18216065

 

prodomImg

pubmed

4

531

S=963 I=44 E=1.04029e-107

Probable alcohol dehydrogenase ; Flavoprotein

Pubmed 16926497

 

prodomImg

pubmed

5

537

S=955 I=39 E=9.77881e-107

Alcohol dehydrogenase ; Flavoprotein

Pubmed 11872724,11872725

 

prodomImg

sp_Pdown

sp|Q3BXK8|BETA_XANC5

1

555

S=2938 I=99 E=0

Choline dehydrogenase EC=1.1.99.1 ; FAD Flavoprotein Oxidoreductase

sp_Pdown

sp|Q8PPG8|BETA_XANAC

1

555

S=2932 I=99 E=0

Choline dehydrogenase EC=1.1.99.1 ; FAD Flavoprotein Oxidoreductase

sp_Pdown

sp|Q8P5D7|BETA_XANCP

1

556

S=2901 I=97 E=0

Choline dehydrogenase EC=1.1.99.1 ; FAD Flavoprotein Oxidoreductase

sp_Pdown

sp|B0RNU9|BETA_XANCB

1

556

S=2901 I=97 E=0

Choline dehydrogenase EC=1.1.99.1 ; FAD Flavoprotein Oxidoreductase

sp_Pdown

sp|Q4UYN5|BETA_XANC8

1

556

S=2901 I=97 E=0

Choline dehydrogenase EC=1.1.99.1 ; FAD Flavoprotein Oxidoreductase

Iprscan [G3DSA:3.50.50.60]

4

540

-

Iprscan [MF_00750]

3

556

-

Iprscan IPR012132 [PIRSF000137]

1

541

Glucose-methanol-choline oxidoreductase

Iprscan IPR000172 [PF00732]

5

303

Glucose-methanol-choline oxidoreductase, N-terminal

Iprscan IPR007867 [PF05199]

393

529

Glucose-methanol-choline oxidoreductase, C-terminal

Iprscan IPR011533 [TIGR01810]

6

539

Choline dehydrogenase

Iprscan IPR000172 [PS00623]

84

107

Glucose-methanol-choline oxidoreductase, N-terminal

Iprscan IPR000172 [PS00624]

261

275

Glucose-methanol-choline oxidoreductase, N-terminal

PD017632

87

180

S=244 I=54 E=4.93124e-22

PD210869

260

317

S=206 I=67 E=2.26018e-17

PDA1F7G4

321

388

S=203 I=51 E=4.99707e-17

PD528113

48

112

S=182 I=55 E=1.54966e-14

PD951145

1

38

S=152 I=74 E=6.74632e-11

PD353232

181

257

S=139 I=48 E=2.67284e-09

PDA0V8T9

67

131

S=134 I=37 E=9.54557e-09

PD448663

430

474

S=132 I=62 E=1.72697e-08

PD115666

473

536

S=123 I=46 E=2.32093e-07

PDA2C9J1

369

390

S=116 I=95 E=1.51273e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one M4SUMSbv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

132 hits
swiss-prot

Swiss-Prot ncbi-blastp

143 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExOadU/XFF4834R_chr07260.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExOadU/XFF4834R_chr07260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExOadU/XFF4834R_chr07260.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExOadU/XFF4834R_chr07260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
betB XFF4834R_chr07270
XFF4834R_chr07260
XFF4834R_chr07260
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07280
XFF4834R_chr07280
ID betB
AC XFF4834R_chr07270
LT XFF4834R_chr07270
OR XFF4834R_chr from 841012 to 842484 on strand -
DE Probable betaine aldehyde dehydrogenase
IP Betaine aldehyde dehydrogenase; Aldehyde dehydrogenase, conserved site
CL 1.7.18 Betaine biosynthesis GO:0006578
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Biological Process: betaine biosynthetic process (GO:0006578)
Molecular Function: betaine-aldehyde dehydrogenase activity (GO:0008802)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100503)
MW 52429.1 Da
SQ 490 aa
 
........10........20........30........40........50
| | | | |
MPRFPDRLLYIGGRYVPARGGHTFEVVNPATGEVLANVHNAGADDLDAAV
DSAKAGQQRWAALTTVERSRILLRAVALLRERNDALAELETLNTGKPLSE
TRSVDVVTGADVLEYYAGVAQALQGAQVPLREGSFFYTRHEPLGVVGAIG
AWNYPIQIALWKAAPALAAGNAMIFKPSEVTPLTALKLAEIFTEAGLPDG
VFNVLPGDGASVGTALTEHPQIEKISFTGGTATGRKVMASASSSSLKEVT
MELGGKSPLIVCADADLDLAADIAMMANFYSSGQVCTNGTRVFVPRALRH
AFEARLLARVQRIHIGDPLDERTTFGPLVSAAHMQRVLEHIEQGKAEGAR
LLCGGERLQDGALAQGYYVAPTIFSDCTDVMTIVREEIFGPVLSLLTYDD
EDEAVTRANATTYGLAAGVVTPDLARAHRLIHRLEAGICWVNTWGESPAP
MPVGGYKQSGVGRENGLATLQAYTRTKSVQIELERYASVF
XFF4834R

XFF4834R_chr01250 lcl|aldB-XFF4834R_chr01250

2

481

S=788 I=38 E=9.44746e-89

aldehyde dehydrogenase B

XFF4834R

XFF4834R_chr08850 lcl|XFF4834R_chr09420449_1027918_r3_XFF4834R-XFF4834R_chr08850

9

481

S=635 I=35 E=3.44162e-70

XFF4834R

XFF4834R_chr24530 lcl|sad-XFF4834R_chr24530

23

481

S=478 I=30 E=3.15922e-51

predicted aldehyde dehydrogenase

XFF4834R

XFF4834R_chr31940 lcl|XFF4834R_chr34480466_3665971_r3_XFF4834R-XFF4834R_chr31940

5

479

S=446 I=32 E=2.71493e-47

XFF4834R

XFF4834R_chr19380 lcl|XFF4834R_chr20740024_2218556_r2_XFF4834R-XFF4834R_chr19380

10

482

S=418 I=28 E=6.70605e-44

XFF4834R

XFF4834R_chr37780 lcl|putA-XFF4834R_chr37780

26

466

S=367 I=29 E=1.04088e-37

fused DNA-binding transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

XFF4834R

XFF4834R_chr41130 lcl|XFF4834R_chr_4776385_4777803_r1_XFF4834R-XFF4834R_chr41130

140

442

S=261 I=30 E=7.07731e-25

XFF4834R

XFF4834R_chr01250 lcl|aldB-XFF4834R_chr01250

2

481

S=788 I=38 E=9.44746e-89

aldehyde dehydrogenase B

XFF4834R

XFF4834R_chr08850 lcl|XFF4834R_chr09420449_1027918_r3_XFF4834R-XFF4834R_chr08850

9

481

S=635 I=35 E=3.44162e-70

XFF4834R

XFF4834R_chr24530 lcl|sad-XFF4834R_chr24530

23

481

S=478 I=30 E=3.15922e-51

predicted aldehyde dehydrogenase

XFF4834R

YP_362506.1 lcl|betB-XCV0775

1

490

S=2314 I=91 E=0

betaine aldehyde dehydrogenase

XFF4834R

NP_641072.1 lcl|betB-XAC0719

1

490

S=2312 I=90 E=0

betaine aldehyde dehydrogenase

XFF4834R

NP_638749.1 lcl|betB-XCC3403

1

490

S=2175 I=88 E=0

betaine aldehyde dehydrogenase

XFF4834R

lcl|XALc_2105

10

483

S=854 I=39 E=3.21127e-96

putative aldehyde dehydrogenase protein

XFF4834R

NP_635496.1 lcl|aldA-XCC0101

2

481

S=780 I=37 E=2.87061e-87

chloroacetaldehyde dehydrogenase

XFF4834R

NP_640485.2 lcl|aldA-XAC0129

2

481

S=771 I=37 E=4.43544e-86

chloroacetaldehyde dehydrogenase

XFF4834R

YP_361836.1 lcl|XCV0105

2

481

S=765 I=37 E=2.14929e-85

putative aldehyde dehydrogenase

XFF4834R

NP_641234.1 lcl|badH-XAC0882

9

481

S=639 I=35 E=3.87367e-70

aldehyde dehydrogenase

XFF4834R

YP_362648.1 lcl|XCV0917

9

481

S=627 I=35 E=1.1019e-68

putative aldehyde dehydrogenase

XFF4834R

lcl|XALc_3040

13

481

S=542 I=33 E=2.4371e-58

putative aldehyde dehydrogenase protein

pubmed

1

490

S=1641 I=63 E=0

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase Stress response

Pubmed 1956285,1879697

 

prodomImg

pubmed

9

490

S=1558 I=62 E=6.65848e-180

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase

Pubmed 10708384

 

prodomImg

pubmed

5

483

S=1144 I=49 E=1.09649e-129

Betaine aldehyde dehydrogenase 1 EC=1.2.1.8 ; NAD Oxidoreductase

Pubmed 9141699

 

prodomImg

pubmed

10

484

S=1111 I=48 E=8.56115e-126

Betaine aldehyde dehydrogenase 2 EC=1.2.1.8 ; NAD Oxidoreductase Plasmid

Pubmed 11481432

 

prodomImg

pubmed

8

490

S=1093 I=45 E=1.33327e-123

4-trimethylaminobutyraldehyde dehydrogenase EC=1.2.1.47 EC=1.2.1.3 EC=1.2.1.19 ; Acetylation Cytoplasm NAD Oxidoreductase Polymorphism

Pubmed 8786138,10702312

 

prodomImg

pubmed

8

490

S=1089 I=45 E=4.21441e-123

4-trimethylaminobutyraldehyde dehydrogenase EC=1.2.1.47 EC=1.2.1.3 ; Acetylation Cytoplasm NAD Oxidoreductase

Pubmed 10702312

 

prodomImg

pubmed

6

490

S=1087 I=45 E=7.89524e-123

Betaine aldehyde dehydrogenase EC=1.2.1.8 EC=1.2.1.3 ; Cytoplasm NAD Oxidoreductase

Pubmed 9792097

 

prodomImg

pubmed

8

490

S=1072 I=45 E=5.18666e-121

4-trimethylaminobutyraldehyde dehydrogenase EC=1.2.1.47 EC=1.2.1.3 ; Acetylation Cytoplasm NAD Oxidoreductase

Pubmed 10702312

 

prodomImg

pubmed

6

482

S=1065 I=44 E=3.18039e-120

Aldehyde dehydrogenase family 9 member A1 EC=1.2.1.3 ; Cytoplasm NAD Oxidoreductase

Pubmed 17236798

 

prodomImg

pubmed

9

481

S=911 I=39 E=1.67094e-101

Aldehyde dehydrogenase, mitochondrial EC=1.2.1.3 ; Mitochondrion NAD Oxidoreductase RNA-binding Transit peptide

Pubmed 7630384

 

prodomImg

sp_Pdown

sp|Q3BXK7|BETB_XANC5

1

490

S=2314 I=91 E=0

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase

sp_Pdown

sp|Q8PPG7|BETB_XANAC

1

490

S=2312 I=90 E=0

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase

sp_Pdown

sp|B0RNV0|BETB_XANCB

1

490

S=2187 I=88 E=0

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase

sp_Pdown

sp|Q4UYN4|BETB_XANC8

1

490

S=2187 I=88 E=0

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase

sp_Pdown

sp|Q8P5D8|BETB_XANCP

1

490

S=2175 I=88 E=0

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase

PDA9F7Z1

183

463

S=200 I=23 E=1.06082e-16

PD250846

195

252

S=173 I=57 E=2.3192e-13

PDA7U8X4

278

352

S=159 I=40 E=1.03814e-11

PDA181A7

346

408

S=154 I=48 E=4.18886e-11

PDA1L8M5

253

299

S=149 I=66 E=1.78097e-10

PD863666

9

61

S=145 I=53 E=5.34264e-10

PDA1C3Y3

19

89

S=144 I=44 E=6.36042e-10

PDA4T9J7

5

89

S=143 I=33 E=9.83583e-10

PD284668

376

438

S=136 I=43 E=7.11783e-09

PDA28093

444

490

S=130 I=54 E=3.5405e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one NVQUCxpb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

7 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExOadU/XFF4834R_chr07270.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExOadU/XFF4834R_chr07270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExOadU/XFF4834R_chr07270.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBExOadU/XFF4834R_chr07270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.