Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr02980purUXFF4834R_chr02980 probable formyltetrahydrofolate hydrolase
  2. XFF4834R_chr07950metFXFF4834R_chr079505,10-methylenetetrahydrofolate reductase
  3. XFF4834R_chr08500folAXFF4834R_chr08500probable dihydrofolate reductase

purU XFF4834R_chr02980
XFF4834R_chr02970
XFF4834R_chr02970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02990
XFF4834R_chr02990
ID purU
AC XFF4834R_chr02980
LT XFF4834R_chr02980
OR XFF4834R_chr from 345897 to 346748 on strand +
DE probable formyltetrahydrofolate hydrolase
IP Formyltetrahydrofolate deformylase
CL 1.7.17 Formyl-tetrahydrofolate biosynthesis GO:0009257
EC
GO InterPro
Biological Process: 'de novo' IMP biosynthetic process (GO:0006189)
Biological Process: metabolic process (GO:0008152)
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: amino acid binding (GO:0016597)
Molecular Function: formyltetrahydrofolate deformylase activity (GO:0008864)
formyl- and related transferase activity (GO:0016742)

Curated
PM
AN modif du start
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110701)
MW 31745.2 Da
SQ 283 aa
 
........10........20........30........40........50
| | | | |
MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRV
HFDKPAKTDIATLEQRFAVLADEFQMAWQLHDARRRARLLVLVSKQGHCL
NDLLFRMHSRQLPVEIAAVVSNHTDFAALAGSYGIAFHHLPVSADTRAAQ
EAQLLALVDALQIDLVVLARYMQILSPQLCRALAGRAINIHHSFLPSFKG
AQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHAMTPRDLVR
LGSDIESLVLARAVRRHVEHRIVLNGHRTVVFR
XFF4834R

XFF4834R_chr16780 purN-XFF4834R_chr16780

162

234

S=138 I=42 E=2.51234e-10

phosphoribosylglycinamide formyltransferase 1

XFF4834R

XFF4834R_chr36920 fmt-XFF4834R_chr36920

153

232

S=96 I=33 E=3.51511e-05

10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase

XFF4834R

NP_640680.1 purU-XAC0324

1

283

S=1376 I=94 E=9.759e-160

formyltetrahydrofolate deformylase

XFF4834R

YP_362064.1 purU-XCV0333

1

283

S=1367 I=93 E=1.20204e-158

formyltetrahydrofolate deformylase

XFF4834R

NP_635705.1 purU-XCC0310

1

283

S=1317 I=89 E=1.33958e-152

formyltetrahydrofolate deformylase

XFF4834R

NP_638139.1 purN-XCC2791

94

234

S=172 I=35 E=7.06911e-14

phosphoribosylglycinamide formyltransferase

XFF4834R

XALc_2128 PurU-XALc_2128

94

250

S=155 I=31 E=9.08758e-12

putative phosphoribosylglycinamide formyltransferase protein

XFF4834R

YP_364837.1 purN-XCV3106

158

234

S=141 I=42 E=3.79378e-10

phosphoribosylglycinamide formyltransferase

XFF4834R

NP_643270.1 purN-XAC2961

162

234

S=139 I=42 E=8.38773e-10

phosphoribosylglycinamide formyltransferase

XFF4834R

NP_639093.1 fmt-XCC3748

153

232

S=102 I=34 E=2.55192e-05

methionyl-tRNA formyltransferase

XFF4834R

XALc_2857 Fmt-XALc_2857

160

244

S=98 I=34 E=7.01618e-05

putative methionyl-trna formyltransferase protein

pubmed

6

282

S=776 I=55 E=1.87274e-85

Putative formyltetrahydrofolate deformylase ; Plasmid

Pubmed 7815950,8588735

 

prodomImg

pubmed

3

283

S=749 I=54 E=3.75241e-82

Putative 10-formyltetrahydrofolate deformylase

Pubmed 11422368

 

prodomImg

pubmed

5

283

S=733 I=52 E=3.20205e-80

Formyltetrahydrofolate deformylase EC=3.5.1.10 ; Hydrolase One-carbon metabolism Purine biosynthesis

Pubmed 7543100

 

prodomImg

pubmed

5

283

S=731 I=52 E=5.26331e-80

Putative formyltetrahydrofolate deformylase

Pubmed 11422368

 

prodomImg

pubmed

5

282

S=705 I=50 E=8.48065e-77

PurU protein

Pubmed 10200311

 

prodomImg

sp_Pdown

sp|Q46339|PURU_CORS1

5

283

S=733 I=52 E=2.18166e-80

Formyltetrahydrofolate deformylase EC=3.5.1.10 ; Hydrolase One-carbon metabolism Purine biosynthesis

sp_Pdown

sp|O34990|PURU_BACSU

7

282

S=653 I=46 E=1.21689e-70

Formyltetrahydrofolate deformylase EC=3.5.1.10 ; Hydrolase One-carbon metabolism Purine biosynthesis

sp_Pdown

sp|Q55135|PURU_SYNY3

7

282

S=640 I=48 E=4.19345e-69

Formyltetrahydrofolate deformylase EC=3.5.1.10 ; Hydrolase One-carbon metabolism Purine biosynthesis

sp_Pdown

sp|P0A5T6|PURU_MYCTU

7

282

S=575 I=45 E=2.74105e-61

Formyltetrahydrofolate deformylase EC=3.5.1.10 ; Hydrolase One-carbon metabolism Purine biosynthesis

sp_Pdown

sp|P0A5T7|PURU_MYCBO

7

282

S=575 I=45 E=2.74105e-61

Formyltetrahydrofolate deformylase EC=3.5.1.10 ; Hydrolase One-carbon metabolism Purine biosynthesis

Iprscan IPR004810 [PR01575]

7

33

Formyltetrahydrofolate deformylase

Iprscan IPR004810 [PR01575]

39

51

Formyltetrahydrofolate deformylase

Iprscan IPR004810 [PR01575]

88

110

Formyltetrahydrofolate deformylase

Iprscan IPR004810 [PR01575]

110

137

Formyltetrahydrofolate deformylase

Iprscan IPR004810 [PR01575]

234

256

Formyltetrahydrofolate deformylase

Iprscan IPR004810 [PR01575]

256

281

Formyltetrahydrofolate deformylase

Iprscan IPR002376 [G3DSA:3.40.50.170]

87

281

Formyl transferase, N-terminal

Iprscan IPR004810 [PIRSF036480]

1

283

Formyltetrahydrofolate deformylase

Iprscan [PTHR10520:SF7]

165

283

-

Iprscan [PTHR10520]

165

283

-

Iprscan IPR002376 [PF00551]

88

264

Formyl transferase, N-terminal

Iprscan IPR002912 [PF01842]

5

66

Amino acid-binding ACT

Iprscan IPR004810 [TIGR00655]

5

282

Formyltetrahydrofolate deformylase

Iprscan [seg]

83

93

-

PD001209

162

275

S=243 I=47 E=6.50625e-22

PD407153

31

109

S=151 I=42 E=9.21697e-11

PDA751U7

108

136

S=127 I=90 E=6.95556e-08

PD403042

111

147

S=123 I=59 E=1.94599e-07

PDA6E9S5

232

271

S=122 I=68 E=2.3781e-07

PDA1F8S3

6

37

S=117 I=66 E=1.15236e-06

PD237291

254

282

S=105 I=66 E=2.85115e-05

PDA1J3X1

112

139

S=103 I=71 E=4.64585e-05

PDA751U2

112

135

S=101 I=88 E=8.55303e-05

Iprscan IPR002376 [SSF53328]

87

283

Formyl transferase, N-terminal

Iprscan [SSF55021]

1

88

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5B4tmoB8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

78 hits
swiss-prot

Swiss-Prot ncbi-blastp

210 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr02980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr02980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr02980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr02980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
metF XFF4834R_chr07950
XFF4834R_chr07940
XFF4834R_chr07940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07960
XFF4834R_chr07960
ID metF
AC XFF4834R_chr07950
LT XFF4834R_chr07950
OR XFF4834R_chr from 919838 to 920665 on strand -
DE 5,10-methylenetetrahydrofolate reductase
IP Methylenetetrahydrofolate reductase; 5,10-methylenetetrahydrofolate reductase
CL 1.7.17 Formyl-tetrahydrofolate biosynthesis GO:0009257
EC
GO InterPro
Biological Process: methionine metabolic process (GO:0006555)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: methionine biosynthetic process (GO:0009086)
Molecular Function: methylenetetrahydrofolate reductase (NADPH) activity (GO:0004489)

Curated
PM
AN according to E.coli annotation
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 30306.2 Da
SQ 275 aa
 
........10........20........30........40........50
| | | | |
MTHLSFEFYPPKTDDQRAQLDRTAARLKGYAPEYVSCTFGAGGSTLSYTS
ETVRHLKQKHGFEAAPHLSCVGGSRQEIRELLKLYRAIGCTRIVALRGDL
PSGMGHPGDLRYASDLIAFIRAEHGDAFRIEVGAYPETHPQAADALSDLR
YFKAKVDAGADAAITQYFYNADAYFHFRDAVQRMGVEIPIIPGIMPISNF
SQLRRFSEQCGAEIPRWIGKKMQSYGDDADAVRAFGAEVVAALCERLIAG
GAPALHFYTLNLAKPTTQVLQLLGR
XFF4834R

NP_641143.1 lcl|metF-XAC0791

1

275

S=1460 I=100 E=5.85676e-170

5,10-methylenetetrahydrofolate reductase

XFF4834R

YP_362573.1 lcl|metF-XCV0842

1

275

S=1449 I=99 E=1.24945e-168

5,10-methylenetetrahydrofolate reductase

XFF4834R

NP_636130.1 lcl|metF-XCC0739

1

275

S=1419 I=96 E=5.88342e-165

5,10-methylenetetrahydrofolate reductase

XFF4834R

lcl|metF-XALc_2802

1

273

S=1302 I=86 E=1.00717e-150

putative 5,10-methylenetetrahydrofolate reductase protein

XFF4834R

NP_635709.1 lcl|metF-XCC0314

61

275

S=110 I=27 E=2.15434e-06

5,10-methylenetetrahydrofolate reductase

XFF4834R

NP_640687.1 lcl|metF-XAC0331

58

211

S=98 I=26 E=7.35951e-05

5,10-methylenetetrahydrofolate reductase

XFF4834R

YP_362071.1 lcl|XCV0340

55

211

S=98 I=27 E=7.55454e-05

putative 5,10-methylenetetrahydrofolate reductase

pubmed

3

273

S=812 I=57 E=8.85059e-90

Methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Oxidoreductase

Pubmed 15305924

 

prodomImg

pubmed

5

273

S=810 I=56 E=1.36867e-89

Methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Oxidoreductase

Pubmed 18460806

 

prodomImg

pubmed

32

274

S=737 I=55 E=9.33714e-81

Methylenetetrahydrofolate reductase EC=1.5.1.20 ; FAD Flavoprotein Oxidoreductase Plasmid

Pubmed 12673061

 

prodomImg

pubmed

3

274

S=567 I=40 E=3.54706e-60

5,10-methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Methionine NAD NADP Oxidoreductase

Pubmed 2841568

 

prodomImg

pubmed

3

274

S=564 I=40 E=8.78345e-60

5,10-methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Methionine NAD NADP Oxidoreductase

Pubmed 6356036,8346018

 

prodomImg

pubmed

4

274

S=555 I=39 E=1.19078e-58

Methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Oxidoreductase

Pubmed 11286884

 

prodomImg

pubmed

3

274

S=516 I=38 E=5.70099e-54

5,10-methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Methionine NAD NADP Oxidoreductase

Pubmed 16645985

 

prodomImg

pubmed

2

274

S=509 I=38 E=4.58063e-53

Methylenetetrahydrofolate reductase 1 EC=1.5.1.20 ; Alternative splicing FAD Flavoprotein NAD Oxidoreductase

Pubmed 10593891

 

prodomImg

pubmed

5

274

S=504 I=39 E=1.51243e-52

Methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Oxidoreductase

Pubmed 17981978

 

prodomImg

pubmed

2

274

S=496 I=36 E=1.43415e-51

Methylenetetrahydrofolate reductase 2 EC=1.5.1.20 ; FAD Flavoprotein NAD Oxidoreductase

Pubmed 10593891

 

prodomImg

sp_Pdown

sp|O67422|METF_AQUAE

4

273

S=596 I=41 E=7.88968e-64

5,10-methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Methionine NAD NADP Oxidoreductase

sp_Pdown

sp|P71319|METF_PECCC

3

274

S=571 I=40 E=9.45122e-61

5,10-methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Methionine NAD NADP Oxidoreductase

sp_Pdown

sp|P11003|METF_SALTY

3

274

S=567 I=40 E=2.44465e-60

5,10-methylenetetrahydrofolate reductase EC=1.5.1.20 ; Amino-acid biosynthesis FAD Flavoprotein Methionine NAD NADP Oxidoreductase

Iprscan [G3DSA:3.20.20.220]

2

275

-

Iprscan [PTHR21091]

67

275

-

Iprscan [PTHR21091]

67

275

-

Iprscan [PTHR21091:SF1]

67

275

-

Iprscan IPR003171 [PF02219]

1

274

Methylenetetrahydrofolate reductase

Iprscan IPR004620 [TIGR00676]

4

274

5,10-methylenetetrahydrofolate reductase

PD406226

3

274

S=694 I=52 E=1.22612e-76

Iprscan [SSF51730]

4

274

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CYCzTfFl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

34 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr07950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr07950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr07950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr07950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
folA XFF4834R_chr08500
XFF4834R_chr08490
XFF4834R_chr08490
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08510
XFF4834R_chr08510
ID folA
AC XFF4834R_chr08500
LT XFF4834R_chr08500
OR XFF4834R_chr from 986707 to 987201 on strand +
DE probable dihydrofolate reductase
IP Dihydrofolate reductase region
CL 1.7.17 Formyl-tetrahydrofolate biosynthesis GO:0009257
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: nucleotide biosynthetic process (GO:0009165)
Biological Process: glycine biosynthetic process (GO:0006545)
Molecular Function: NADP or NADPH binding (GO:0050661)
Molecular Function: dihydrofolate reductase activity (GO:0004146)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 18194.6 Da
SQ 164 aa
 
........10........20........30........40........50
| | | | |
MKLTLIVAFDRNNAIGRDNDLPWKLPDDLKRFRSLTLGKPILMGRKTAQS
LGRALPGRVNLVLTRSGQVPFEGMHAVASVEQAIERAAQDGAQELCVIGG
GEVYRLTMQRADLLAVTEVDTVVDGADTHFPPIDPALWEAVQRESHAADA
RHAFAFDYVDYRRR
XFF4834R

NP_641196.1 lcl|folA-XAC0844

1

164

S=770 I=90 E=1.33243e-86

dihydrofolate reductase type III

XFF4834R

YP_362628.1 lcl|folA-XCV0897

1

164

S=705 I=82 E=9.84013e-79

dihydrofolate reductase

XFF4834R

NP_636179.1 lcl|folA-XCC0788

1

164

S=703 I=80 E=1.5757e-78

dihydrofolate reductase type III

XFF4834R

lcl|XALc_2767

1

164

S=515 I=59 E=9.40372e-56

probable dihydrofolate reductase protein

pubmed

2

163

S=339 I=44 E=7.31999e-33

Dihydrofolate reductase

Pubmed 12511515

 

prodomImg

pubmed

2

163

S=324 I=43 E=4.93619e-31

Putative trimethoprim resistance dihydrofolate reductase

Pubmed 17307981

 

prodomImg

pubmed

1

145

S=313 I=43 E=8.32185e-30

Dihydrofolate reductase type 3 EC=1.5.1.3 ; Antibiotic resistance Methotrexate NADP One-carbon metabolism Oxidoreductase Plasmid Trimethoprim

Pubmed 2840679,6371010

 

prodomImg

pubmed

1

145

S=301 I=43 E=2.56045e-28

Dihydrofolate reductase EC=1.5.1.3 ; Oxidoreductase

Pubmed 12949104

 

prodomImg

pubmed

1

141

S=296 I=38 E=1.03314e-27

Dihydrofolate reductase ; Oxidoreductase

Pubmed 15561838

 

prodomImg

pubmed

3

164

S=296 I=36 E=1.05131e-27

Dihydrofolate reductase EC=1.5.1.3 ; NADP One-carbon metabolism Oxidoreductase

Pubmed 2840350,8969496

 

prodomImg

pubmed

1

141

S=291 I=37 E=3.75457e-27

Dihydrofolate reductase

Pubmed 16127079,12270839

 

prodomImg

pubmed

1

145

S=285 I=42 E=2.32241e-26

Trimethoprim-resistance dihydrofolate reductase

Pubmed 15715715

 

prodomImg

pubmed

1

145

S=284 I=42 E=2.86296e-26

Trimethoprim-resistance dihydrofolate reductase

Pubmed 15715715

 

prodomImg

pubmed

1

145

S=282 I=42 E=5.80126e-26

Dfr23 protein

Pubmed 18990526

 

prodomImg

sp_Pdown

sp|P12833|DYR3_SALTY

1

145

S=313 I=43 E=5.80491e-30

Dihydrofolate reductase type 3 EC=1.5.1.3 ; Antibiotic resistance Methotrexate NADP One-carbon metabolism Oxidoreductase Plasmid Trimethoprim

sp_Pdown

sp|P11045|DYR_BACSU

3

164

S=296 I=36 E=7.3334e-28

Dihydrofolate reductase EC=1.5.1.3 ; NADP One-carbon metabolism Oxidoreductase

sp_Pdown

sp|P43791|DYR_HAEIN

1

139

S=292 I=45 E=2.03389e-27

Dihydrofolate reductase EC=1.5.1.3 ; Antibiotic resistance NADP One-carbon metabolism Oxidoreductase Trimethoprim

sp_Pdown

sp|P04174|DYR_NEIGO

1

143

S=281 I=42 E=4.45399e-26

Dihydrofolate reductase EC=1.5.1.3 ; Antibiotic resistance NADP One-carbon metabolism Oxidoreductase Trimethoprim

sp_Pdown

sp|P31074|DYR_ENTAE

3

144

S=281 I=45 E=4.45399e-26

Dihydrofolate reductase EC=1.5.1.3 ; NADP One-carbon metabolism Oxidoreductase

Iprscan IPR012259 [PR00070]

14

24

Dihydrofolate reductase

Iprscan IPR012259 [PR00070]

28

36

Dihydrofolate reductase

Iprscan IPR012259 [PR00070]

41

52

Dihydrofolate reductase

Iprscan IPR012259 [PR00070]

94

108

Dihydrofolate reductase

Iprscan [G3DSA:3.40.430.10]

2

164

-

Iprscan IPR012259 [PTHR11549:SF1]

14

152

Dihydrofolate reductase

Iprscan [PTHR11549]

14

152

-

Iprscan IPR001796 [PF00186]

2

163

Dihydrofolate reductase domain

Iprscan [seg]

146

157

-

PDA1L0C1

51

96

S=206 I=87 E=1.98812e-17

PD000692

5

50

S=173 I=63 E=1.57958e-13

PDA464Z9

51

138

S=115 I=35 E=1.71344e-06

PD356639

95

145

S=107 I=45 E=1.66781e-05

Iprscan [SSF53597]

1

164

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3DUm7YJm)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

273 hits
swiss-prot

Swiss-Prot ncbi-blastp

79 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr08500.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr08500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr08500.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB88h9TN/XFF4834R_chr08500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.