Xanthomonas fuscans subsp. fuscans

7 hits

  1. XFF4834R_chr02810XFF4834R_chr02950010_0329179_r3_XFF4834R-XFF4834R_chr02810XFF4834R_chr02810putative nucleoside hydrolase
  2. XFF4834R_chr16050XFF4834R_chr17270692_1853931_f1_XFF4834R-XFF4834R_chr16050XFF4834R_chr16050putative thiol-disulfide isomerase et thioredoxin ; glutaredoxin protein
  3. XFF4834R_chr18940XFF4834R_chr20390652_2175221_f3_XFF4834R-XFF4834R_chr18940XFF4834R_chr18940probable dCTP deaminase activity protein
  4. XFF4834R_chr38010dutXFF4834R_chr38010probable deoxyuridinetriphosphatase
  5. XFF4834R_chr38800tmkXFF4834R_chr38800probable thymidylate kinase
  6. XFF4834R_chr39400nrdBXFF4834R_chr39400probable ribonucleoside-diphosphate reductase 2, beta subunit, ferritin-like
  7. XFF4834R_chr39410nrdAXFF4834R_chr39410probable secreted ribonucleoside-diphosphate reductase 2, alpha subunit

XFF4834R_chr02950010_0329179_r3_XFF4834R-XFF4834R_chr02810 XFF4834R_chr02810
XFF4834R_chr02800
XFF4834R_chr02800
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02820
XFF4834R_chr02820
ID XFF4834R_chr02950010_0329179_r3_XFF4834R-XFF4834R_chr02810
AC XFF4834R_chr02810
LT XFF4834R_chr02810
OR XFF4834R_chr from 328010 to 329179 on strand -
DE putative nucleoside hydrolase
IP Inosine/uridine-preferring nucleoside hydrolase
CL 1.7.15 2'-deoxyribonucleotide/ribonucleoside metabolism GO:0009265
EC
GO InterPro


Curated
PM
AN il faut faire un interproscan pour voir le domain(le meme que les autres xantho)
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100903)
MW 42548 Da
SQ 389 aa
 
........10........20........30........40........50
| | | | |
MPLSIAGAMPSTFHDNNAMTDPHLPSSKRRVILEDDIDGFTPAQLLLLQS
PDVEVLGISAVSGNIWRDEVLAHTCRLLELAGHPQIPVLPGPVHPLLNSE
LATERWEALYGKLVWKGAWTKHWVDGDTVQSAPRYHAPDVVPDLALGNPS
VVRPSDEPAALFMLRMVRQYPGEVSIIATGPLTNLALAQSLDPAFATLAR
ELVYMGGSLNPRQQRNSVSAQQFAREFVNSPRREFNIRWDPEAASIVMRA
PWRQITMVPVDPSTATELTAELLARMSAADTTIGHALRSREPGFPMWDEL
ATAVWLRPELARHTETLYVDTNTAFDAGYGDILSWAPGYQPGLGERAQTV
VHAVDVPAFEQLLVDCLTAPQPPAVGSPFPLLPSGPRSP
XFF4834R

XFF4834R_chr11370 XFF4834R_chr11860685_1270683_f1_XFF4834R-XFF4834R_chr11370

159

280

S=131 I=37 E=2.54265e-09

XFF4834R

XFF4834R_chr12610 rihA-XFF4834R_chr12610

131

250

S=113 I=38 E=4.28303e-07

ribonucleoside hydrolase 1

XFF4834R

NP_640663.1 XAC0307-XAC0307

1

389

S=1959 I=97 E=0

nucleoside hydrolase

XFF4834R

YP_362047.1 XCV0316

1

389

S=1896 I=94 E=0

putative nucleoside hydrolase

XFF4834R

NP_635688.1 XCC0293

19

385

S=1732 I=91 E=0

nucleoside hydrolase

XFF4834R

NP_641480.1 XAC1144-XAC1144

159

271

S=133 I=39 E=5.50619e-09

inosine-uridine preferring nucleoside hydrolase

XFF4834R

XALc_0644 XALc_0644

154

271

S=129 I=41 E=1.72537e-08

putative inosine-uridine preferring nucleoside hydrolase precursor protein

XFF4834R

YP_362893.1 XCV1162

162

271

S=127 I=39 E=3.06756e-08

putative inosine-uridine preferring nucleoside hydrolase

XFF4834R

NP_636413.1 XCC1038

159

280

S=119 I=34 E=3.065e-07

inosine-uridine preferring nucleoside hydrolase

XFF4834R

NP_643697.1 XAC3390-XAC3390

131

250

S=109 I=38 E=4.77726e-06

inosine-uridine preferring nucleoside hydrolase

XFF4834R

YP_365238.1 iunH-XCV3507

132

248

S=104 I=38 E=2.06686e-05

inosine-uridine preferring nucleoside hydrolase

pubmed

27

269

S=180 I=30 E=4.70652e-13

Putative inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16204499

 

prodomImg

pubmed

128

281

S=159 I=31 E=1.9125e-10

Nucleoside hydrolase

Pubmed 16707707

 

prodomImg

pubmed

29

282

S=143 I=28 E=1.37085e-08

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.- ; Calcium Glycosidase Metal-binding Nucleotide metabolism

Pubmed 8634237,8634238

 

prodomImg

pubmed

26

368

S=140 I=28 E=3.97139e-08

Ribonucleoside hydrolase 1

Pubmed 16549679

 

prodomImg

pubmed

156

259

S=132 I=36 E=3.60519e-07

Putative purine hydrolase Salivary purine nucleosidase

Pubmed 12213246,12459196

 

prodomImg

sp_Pdown

sp|Q9HGL1|YHLB_SCHPO

23

369

S=327 I=28 E=5.62838e-31

Uncharacterized protein C800.11 ; Endoplasmic reticulum Glycosidase Hydrolase Signal

sp_Pdown

sp|Q6ZJ05|URH1_ORYSJ

136

276

S=188 I=39 E=3.84755e-14

Probable uridine nucleosidase 1 EC=3.2.2.3 ; Cytoplasm Glycosidase Hydrolase

sp_Pdown

sp|Q8LAC4|URH2_ARATH

26

287

S=178 I=26 E=6.95511e-13

Probable uridine nucleosidase 2 EC=3.2.2.3 ; Alternative splicing Cytoplasm Glycosidase Hydrolase

sp_Pdown

sp|Q9SJM7|URH1_ARATH

136

277

S=177 I=36 E=7.52285e-13

Uridine nucleosidase 1 EC=3.2.2.3 ; Cytoplasm Glycosidase Hydrolase

sp_Pdown

sp|Q9P6J4|YHD6_SCHPO

45

367

S=160 I=26 E=9.33942e-11

Uncharacterized protein C1683.06c ; Cytoplasm Glycosidase Hydrolase Nucleus

Iprscan IPR001910 [G3DSA:3.90.245.10]

15

370

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

27

371

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PF01156]

43

368

Inosine/uridine-preferring nucleoside hydrolase

Iprscan [SignalP-NN(euk)]

1

1

-

PD321547

19

135

S=499 I=81 E=5.13695e-53

PD693765

321

371

S=250 I=94 E=6.85707e-23

PDA151S9

1

44

S=206 I=89 E=1.5633e-17

PD007736

51

367

S=176 I=28 E=6.57247e-14

PD793395

26

119

S=114 I=29 E=2.41638e-06

PDA5L903

158

246

S=108 I=36 E=1.10158e-05

Iprscan IPR001910 [SSF53590]

28

373

Inosine/uridine-preferring nucleoside hydrolase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one j1gkNdgw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr02810.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr02810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr02810.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr02810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr17270692_1853931_f1_XFF4834R-XFF4834R_chr16050 XFF4834R_chr16050
XFF4834R_chr16040
XFF4834R_chr16040
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16060
XFF4834R_chr16060
ID XFF4834R_chr17270692_1853931_f1_XFF4834R-XFF4834R_chr16050
AC XFF4834R_chr16050
LT XFF4834R_chr16050
OR XFF4834R_chr from 1853692 to 1853931 on strand +
DE putative thiol-disulfide isomerase et thioredoxin ; glutaredoxin protein
IP Glutaredoxin 2; Thioredoxin-like fold
CL 1.7.15 2'-deoxyribonucleotide/ribonucleoside metabolism GO:0009265
EC
GO InterPro


Curated
PM
AN nombreux hits blastx ncbi pour hypoth protein et quelques hits pour isomerase et thioredoxine et glutaredoxine dont 1 chez X albilineans ; 1 dom interpro pour thioredoxine et glutaredoxine sur 73aa MAIS sur 62 % seulement de la seq de X albilineans
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20100823)
MW 9092 Da
SQ 79 aa
 
........10........20........30........40........50
| | | | |
MPLTLYQRDDCHLCDQAVEVLAQARAGDFDSVFIDDDAALEAVYGARVPV
LRDARGRELEWPFDRVRLRAWLDEDVAER
XFF4834R

YP_364903.1 lcl|XCV3172

1

79

S=386 I=94 E=1.07125e-40

hypothetical protein

XFF4834R

NP_643344.1 lcl|XAC3035-XAC3035

1

79

S=372 I=96 E=4.83718e-39

hypothetical protein

XFF4834R

NP_638200.1 lcl|XCC2852

1

73

S=305 I=84 E=7.1758e-31

hypothetical protein

XFF4834R

lcl|XALc_2178

1

73

S=259 I=71 E=2.23918e-25

putative thiol-disulfide isomerase and thioredoxin; glutaredoxin protein

Iprscan IPR012335 [G3DSA:3.40.30.10]

1

73

Thioredoxin fold

Iprscan IPR008554 [PF05768]

3

72

Glutaredoxin 2

PDA109A8

1

27

S=141 I=100 E=1.28389e-09

PD864319

32

75

S=117 I=60 E=1.14345e-06

Iprscan IPR012336 [SSF52833]

2

76

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one SZS602zH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr16050.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr16050.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr16050.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr16050.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr20390652_2175221_f3_XFF4834R-XFF4834R_chr18940 XFF4834R_chr18940
XFF4834R_chr18930
XFF4834R_chr18930
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18950
XFF4834R_chr18950
ID XFF4834R_chr20390652_2175221_f3_XFF4834R-XFF4834R_chr18940
AC XFF4834R_chr18940
LT XFF4834R_chr18940
OR XFF4834R_chr from 2174652 to 2175221 on strand +
DE probable dCTP deaminase activity protein
IP Deoxycytidine triphosphate deaminase
CL 1.7.15 2'-deoxyribonucleotide/ribonucleoside metabolism GO:0009265
EC
GO InterPro
Biological Process: dUTP biosynthetic process (GO:0006229)
Biological Process: dUTP metabolic process (GO:0046080)
Molecular Function: protein binding (GO:0005515)
Molecular Function: dCTP deaminase activity (GO:0008829)
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN chez xav nom de gene dcd mais homologie moyenne(27% sur 80%) chez coli en passant par ecogene, domain hamap disparu voir history
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: acur
CC STATUS: curated by brin (20100906)
MW 21261.9 Da
SQ 189 aa
 
........10........20........30........40........50
| | | | |
MSIKSDRWIKRLAEQHAMIEPFEPGQIKHDAAGQRIVSFGTSSYGYDVRC
SREFKVFTNINSTIVDPKHFDPGSFVDIESDVCIIPPNSFALARTVEYFR
IPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPARIY
ANEGVAQMLFFQSDEVCETSYKDRGGKYQGQTGVTLPRT
Show or not Domain decomposition
 
XFF4834R

NP_643049.1 dcd-XAC2740

1

189

S=1015 I=99 E=2.99856e-116

deoxycytidine triphosphate deaminase

XFF4834R

YP_364623.1 dcd-XCV2892

1

189

S=1014 I=99 E=4.43921e-116

deoxycytidine triphosphate deaminase

XFF4834R

NP_637918.1 dcd-XCC2570

1

189

S=1006 I=98 E=4.13667e-115

deoxycytidine triphosphate deaminase

XFF4834R

XALc_0969 dcd-XALc_0969

1

189

S=936 I=91 E=1.27643e-106

probable deoxycytidine triphosphate deaminase (dctp deaminase) protein

pubmed

1

188

S=718 I=65 E=1.03086e-78

Deoxycytidine triphosphate deaminase EC=3.5.4.13 ; Hydrolase Nucleotide metabolism

Pubmed 18593465

 

prodomImg

pubmed

1

188

S=691 I=65 E=1.84419e-75

Deoxycytidine triphosphate deaminase EC=3.5.4.13 ; Hydrolase Nucleotide metabolism

Pubmed 18713059

 

prodomImg

pubmed

1

188

S=691 I=64 E=2.10186e-75

Putative uncharacterized protein

Pubmed 11461915,12406231

 

prodomImg

pubmed

1

189

S=680 I=64 E=4.56289e-74

Deoxycytidine triphosphate deaminase EC=3.5.4.13 ; Hydrolase Nucleotide metabolism

Pubmed 19197347

 

prodomImg

pubmed

1

187

S=665 I=65 E=3.05025e-72

Deoxycytidine triphosphate deaminase EC=3.5.4.13 ; Hydrolase Nucleotide metabolism

Pubmed 18550617

 

prodomImg

sp_Pdown

sp|Q8PJ05|DCD_XANAC

1

189

S=1015 I=99 E=7.74714e-115

Deoxycytidine triphosphate deaminase EC=3.5.4.13 ; Hydrolase Nucleotide metabolism

sp_Pdown

sp|Q3BRJ0|DCD_XANC5

1

189

S=1014 I=99 E=1.14692e-114

Deoxycytidine triphosphate deaminase EC=3.5.4.13 ; Hydrolase Nucleotide metabolism

sp_Pdown

sp|Q8P7P1|DCD_XANCP

1

189

S=1006 I=98 E=1.06876e-113

Deoxycytidine triphosphate deaminase EC=3.5.4.13 ; Hydrolase Nucleotide metabolism

sp_Pdown

sp|B0RR56|DCD_XANCB

1

189

S=1006 I=98 E=1.06876e-113

Deoxycytidine triphosphate deaminase EC=3.5.4.13 ; Hydrolase Nucleotide metabolism

sp_Pdown

sp|Q4UWF9|DCD_XANC8

1

189

S=1006 I=98 E=1.06876e-113

Deoxycytidine triphosphate deaminase EC=3.5.4.13 ; Hydrolase Nucleotide metabolism

Iprscan [G3DSA:2.70.40.10]

1

188

-

Iprscan IPR011962 [MF_00146]

1

189

Deoxycytidine triphosphate deaminase

Iprscan IPR008180 [PF00692]

77

184

DeoxyUTP pyrophosphatase domain

Iprscan IPR011962 [TIGR02274]

3

189

Deoxycytidine triphosphate deaminase

PD004900

92

188

S=321 I=61 E=1.85447e-31

PD190066

1

60

S=234 I=61 E=7.88751e-21

PDA0W033

61

91

S=126 I=81 E=8.00912e-08

Iprscan [SSF51283]

1

169

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one s5Awn8in)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

46 hits
swiss-prot

Swiss-Prot ncbi-blastp

412 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr18940.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr18940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr18940.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr18940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
dut XFF4834R_chr38010
XFF4834R_chr38000
XFF4834R_chr38000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38020
XFF4834R_chr38020
ID dut
AC XFF4834R_chr38010
LT XFF4834R_chr38010
OR XFF4834R_chr from 4390803 to 4391270 on strand -
DE probable deoxyuridinetriphosphatase
IP DeoxyUTP pyrophosphatase domain
CL 1.7.15 2'-deoxyribonucleotide/ribonucleoside metabolism GO:0009265
EC
GO InterPro
Biological Process: dUTP metabolic process (GO:0046080)
Molecular Function: dUTP diphosphatase activity (GO:0004170)
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN signal peptide a verif
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 16353.7 Da
SQ 155 aa
 
........10........20........30........40........50
| | | | |
MSPPTQSLQVKLLDPRFGDLWPLPAYATESSAGMDLRAALEAPMTLQPGD
AALIPSGIAIHLADPQLCAVILPRSGLGHRHGIVLGNGTGLIDADYQGPL
LISTWNRGREAFTIEPGDRIAQLVILPIVRMGLQVVDTFVDSARGAGGFG
HTGVR
Show or not Domain decomposition
 
XFF4834R

YP_365757.1 lcl|dut-XCV4026

1

155

S=793 I=100 E=1.96022e-89

deoxyuridine 5'-triphosphate nucleotidohydrolase

XFF4834R

NP_644214.1 lcl|dut-XAC3913

1

155

S=793 I=100 E=1.96022e-89

deoxyuridine 5'-triphosphate nucleotidohydrolase

XFF4834R

NP_639198.1 lcl|dut-XCC3858

5

155

S=747 I=96 E=7.5405e-84

deoxyuridine 5'-triphosphate nucleotidohydrolase

XFF4834R

lcl|dut-XALc_0374

1

155

S=671 I=83 E=1.06071e-74

probable deoxyuridine 5'-triphosphate nucleotidohydrolase (dutp pyrophosphatase) protein

pubmed

6

153

S=490 I=59 E=3.05972e-51

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 6139280,7686882

 

prodomImg

pubmed

17

155

S=405 I=52 E=6.70853e-41

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 10988064

 

prodomImg

pubmed

8

154

S=310 I=48 E=1.99406e-29

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 17916642

 

prodomImg

pubmed

8

155

S=306 I=45 E=5.38765e-29

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 10976061

 

prodomImg

pubmed

22

153

S=300 I=53 E=2.92403e-28

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 18524787

 

prodomImg

pubmed

8

153

S=280 I=42 E=7.29187e-26

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 15618402

 

prodomImg

pubmed

8

155

S=273 I=41 E=5.46414e-25

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 18508905

 

prodomImg

pubmed

16

155

S=271 I=43 E=9.5468e-25

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 17483455

 

prodomImg

pubmed

10

154

S=269 I=42 E=1.69733e-24

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 16707693

 

prodomImg

pubmed

7

153

S=261 I=39 E=1.4751e-23

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Pubmed 18550617

 

prodomImg

sp_Pdown

sp|Q3BNA6|DUT_XANC5

1

155

S=793 I=100 E=4.39354e-88

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

sp_Pdown

sp|Q8PFR5|DUT_XANAC

1

155

S=793 I=100 E=4.39354e-88

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

sp_Pdown

sp|Q2P8A8|DUT_XANOM

1

155

S=780 I=99 E=1.68102e-86

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

sp_Pdown

sp|Q5H5L9|DUT_XANOR

1

155

S=774 I=98 E=8.7342e-86

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

sp_Pdown

sp|B2SS19|DUT_XANOP

1

155

S=774 I=98 E=8.7342e-86

Deoxyuridine 5'-triphosphate nucleotidohydrolase EC=3.6.1.23 ; Nucleotide metabolism

Iprscan [G3DSA:2.70.40.10]

10

153

-

Iprscan [MF_00116]

10

154

-

Iprscan [PTHR11241]

14

155

-

Iprscan IPR008180 [PF00692]

21

153

DeoxyUTP pyrophosphatase domain

Iprscan IPR008181 [TIGR00576]

11

154

DeoxyUTP pyrophosphatase domain, subfamily 1,

PD068009

75

153

S=175 I=46 E=8.3876e-14

PDA1U765

46

81

S=147 I=78 E=2.18306e-10

PDA1F9S4

8

45

S=136 I=68 E=5.593e-09

PDA2A4E2

24

80

S=130 I=50 E=2.93144e-08

PDA316B9

51

80

S=114 I=63 E=2.50149e-06

PDA1F8L3

23

81

S=104 I=37 E=3.93309e-05

Iprscan [SSF51283]

9

154

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4EHsepsj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

225 hits
swiss-prot

Swiss-Prot ncbi-blastp

422 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr38010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr38010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr38010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr38010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
tmk XFF4834R_chr38800
XFF4834R_chr_4130
XFF4834R_chr_4130
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38810
XFF4834R_chr38810
ID tmk
AC XFF4834R_chr38800
LT XFF4834R_chr38800
OR XFF4834R_chr from 4471526 to 4472209 on strand +
DE probable thymidylate kinase
IP Thymidylate kinase-like
CL 1.7.15 2'-deoxyribonucleotide/ribonucleoside metabolism GO:0009265
EC
GO InterPro
Biological Process: dTDP biosynthetic process (GO:0006233)
Molecular Function: thymidylate kinase activity (GO:0004798)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 24074.1 Da
SQ 227 aa
 
........10........20........30........40........50
| | | | |
MTIELKPGGLLIAIEGIDGAGKTTLARRLATTLEAAGARVVLSKEPTNGP
WGTQLRQSAATGRLSAEEEAELLIRDRHEHVDTLIAPALARGDIVILDRY
FPSMVAYQGAAGLPLDELLERNAFAPRPDVLLLLDLPPPTGLARIRARGD
APNHFETQDNLERCRTIFAALELPGKHVVDASADADSVLRQAHAIIVAAL
ADRLSGDAAHTDTGKAALELLSAGRPA
XFF4834R

NP_644314.1 lcl|tdk-XAC4014

1

227

S=951 I=85 E=2.05315e-108

thymidylate kinase

XFF4834R

YP_365838.1 lcl|tdk-XCV4107

1

227

S=928 I=84 E=1.23514e-105

thymidylate kinase

XFF4834R

NP_639271.1 lcl|tdk-XCC3931

1

227

S=782 I=74 E=6.60894e-88

thymidylate kinase

XFF4834R

lcl|tmk-XALc_0631

11

182

S=127 I=30 E=1.70104e-08

probable thymidylate kinase (dtmp kinase) protein

pubmed

10

203

S=209 I=32 E=6.92456e-17

Probable thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 18790866

 

prodomImg

pubmed

9

116

S=149 I=36 E=1.13158e-09

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 18192393

 

prodomImg

pubmed

9

116

S=148 I=36 E=1.46987e-09

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 18192381

 

prodomImg

pubmed

40

125

S=144 I=41 E=4.56589e-09

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 12904564,14661021

 

prodomImg

pubmed

10

202

S=140 I=26 E=1.7182e-08

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 14762060

 

prodomImg

pubmed

10

122

S=139 I=34 E=2.01016e-08

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 15780005

 

prodomImg

pubmed

10

125

S=135 I=33 E=5.57509e-08

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 16672622

 

prodomImg

pubmed

9

108

S=135 I=34 E=7.05485e-08

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 18505588

 

prodomImg

pubmed

10

122

S=133 I=33 E=9.9988e-08

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 18550617

 

prodomImg

pubmed

76

196

S=129 I=32 E=3.18826e-07

Probable thymidylate kinase 1 EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Pubmed 10701121

 

prodomImg

sp_Pdown

sp|Q8PFG7|KTHY_XANAC

1

227

S=951 I=85 E=5.07059e-107

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q3BN25|KTHY_XANC5

1

227

S=928 I=84 E=3.05037e-104

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q5H5T5|KTHY_XANOR

1

227

S=909 I=82 E=7.21924e-102

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|B2SS96|KTHY_XANOP

1

227

S=909 I=82 E=7.21924e-102

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q2P8H9|KTHY_XANOM

1

227

S=909 I=82 E=7.21924e-102

Thymidylate kinase EC=2.7.4.9 ; ATP-binding Nucleotide biosynthesis Nucleotide-binding Transferase

Iprscan [G3DSA:3.40.50.300]

8

213

-

Iprscan IPR018094 [MF_00165]

10

200

Thymidylate kinase

Iprscan IPR018094 [PTHR10344]

9

204

Thymidylate kinase

Iprscan IPR000062 [PF02223]

14

188

Thymidylate kinase-like

Iprscan IPR018094 [TIGR00041]

5

192

Thymidylate kinase

Iprscan [seg]

20

39

-

Iprscan [seg]

126

139

-

PD598233

140

227

S=253 I=58 E=3.49082e-23

Iprscan [SSF52540]

7

196

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4v7ZKJrw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

263 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr38800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr38800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr38800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr38800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
nrdB XFF4834R_chr39400
XFF4834R_chr39390
XFF4834R_chr39390
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39410
XFF4834R_chr39410
ID nrdB
AC XFF4834R_chr39400
LT XFF4834R_chr39400
OR XFF4834R_chr from 4534722 to 4535765 on strand -
DE probable ribonucleoside-diphosphate reductase 2, beta subunit, ferritin-like
IP Ribonucleotide reductase; Ferritin/ribonucleotide reductase-like
CL 1.7.15 2'-deoxyribonucleotide/ribonucleoside metabolism GO:0009265
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: deoxyribonucleoside diphosphate metabolic process (GO:0009186)
Molecular Function: ribonucleoside-diphosphate reductase activity (GO:0004748)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: transition metal ion binding (GO:0046914)

Curated
PM
AN chez xav xac xcc nrdF chez xalc nrdB je ne trouve pas d explic pas d homologie entre F et B chez coli pas de publi chez coli pour nrdF fait parti de ferritin like superfamily
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 39519 Da
SQ 347 aa
 
........10........20........30........40........50
| | | | |
MSATPLDRIKILEPRNPNRSTGIINGQTSGILNWNDIPYPSFYRAYKELS
TNFWIPDEVDMKGDARQYNELSAREKNAYDSIIGLLATLDSPQTRFIYNV
AEYITDPAAHANAAIIGQQEVIHNESYSYVLASITGLADQNRVFEIARTH
PTIIKRNAPIMGAYEDFMREKTAETLIRSLIQSSILEGINFYSGFAYFYN
LVRQNRMTGTGKIISFINRDELAHSKFISELIRAIIGENQALQGDQLTDY
VHKAFEHAIDLETQWTAEVLDGIDGIDVDEMIRYVKYRANKMAGMLGIEK
LYEGANDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNSDNGFDDL
Show or not Domain decomposition
 
XFF4834R

NP_644373.1 lcl|nrdF-XAC4074

1

347

S=1846 I=100 E=0

ribonucleotide-diphosphate reductase subunit beta

XFF4834R

YP_365891.1 lcl|nrdF-XCV4160

1

347

S=1845 I=99 E=0

ribonucleotide-diphosphate reductase subunit beta

XFF4834R

NP_639324.1 lcl|nrdF-XCC3985

1

347

S=1816 I=98 E=0

ribonucleotide-diphosphate reductase subunit beta

XFF4834R

lcl|nrdB-XALc_0162

3

347

S=1696 I=91 E=0

probable ribonucleotide-diphosphate reductase beta subunit protein

Iprscan IPR012348 [G3DSA:1.10.620.20]

7

317

Ribonucleotide reductase-related

Iprscan [PTHR23409:SF5]

23

346

-

Iprscan IPR000358 [PTHR23409]

23

346

Ribonucleotide reductase

Iprscan IPR000358 [PF00268]

33

309

Ribonucleotide reductase

Iprscan IPR009078 [SSF47240]

7

318

Ferritin/ribonucleotide reductase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one o8Nj0KFv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

208 hits
swiss-prot

Swiss-Prot ncbi-blastp

74 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr39400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr39400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr39400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr39400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
nrdA XFF4834R_chr39410
XFF4834R_chr39400
XFF4834R_chr39400
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39420
XFF4834R_chr39420
ID nrdA
AC XFF4834R_chr39410
LT XFF4834R_chr39410
OR XFF4834R_chr from 4535940 to 4538438 on strand -
DE probable secreted ribonucleoside-diphosphate reductase 2, alpha subunit
IP Ribonucleotide reductase large subunit, C-terminal; Ribonucleotide reductase R1 subunit, N-terminal
CL 1.7.15 2'-deoxyribonucleotide/ribonucleoside metabolism GO:0009265
EC
GO InterPro
Biological Process: DNA replication (GO:0006260)
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: ribonucleoside-diphosphate reductase complex (GO:0005971)
Molecular Function: ribonucleoside-diphosphate reductase activity (GO:0004748)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: protein binding (GO:0005515)

Curated
PM
AN changement de nom de gene nrdE en nrdA pour etre comme xantho et coli
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 94186.4 Da
SQ 832 aa
 
........10........20........30........40........50
| | | | |
MTTNDTLSAIAAGTAIPTSVPASVAAPACGAPELTDPSDIVPPPRQAIAM
HAQTIEEQNVSTWITKEAGNRKIPFEPERLERAIDQIHAEFPQLDVADYK
RSVFGFVERKDSVNADDLVDHLIREAEARVDLTTPEWEHFAARLYLRRLY
KRASRNRFYDASQKYGSFVGLQESLADRNVYSNDILRRYSKDELIEAGKM
IEPERDKLFAYNGLYLLATRYLATDSSRGVFELPQERWLTIALYLMQDEI
GTGKGSRERRMQLVGEAYWALSNLYMTVATPTLANAGKVGGQLSSCFIDT
VDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVSNSSGGVV
PWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIEAFLDLRLNNGDQRLR
AHDVFTSVCIPDLFMEAVERRGDWYLFDPHEVKRIKGWYLQDFFDEKKGD
ANGSFRRKYEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEV
NRKNPNKHEGMVYSSNLCTEILQNMSPTRMMQEIISGNQIVTTKKAGDFV
VCNLSSINLGRAITVQADQADLLGADVLERLIPIQVRMLDNVIDLNQLPV
PQATITNQKYRAIGLGTFGWHHLLAQKSIHWNAKEAEDYSDELYERINYL
TIQASMELAKEKGTYSVFRGSDWHNGEYFRARDYNSPQWLELSAQVAVNG
VRNAWMLAVAPNMSTAQIAGSTASIDPIYSAFYYEEKKDFRRPVAAPGLS
LETWPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNFYVPSTIRASTLL
DLHMTAWREGLKTTYYVRSNDIDISECEWCSS
Show or not Domain decomposition
 
XFF4834R

NP_644374.1 lcl|nrdA-XAC4075

1

832

S=4335 I=97 E=0

ribonucleotide-diphosphate reductase subunit alpha

XFF4834R

YP_365892.1 lcl|nrdA-XCV4161

1

832

S=4329 I=97 E=0

ribonucleotide-diphosphate reductase subunit alpha

XFF4834R

NP_639325.1 lcl|nrdA-XCC3986

1

832

S=4159 I=93 E=0

ribonucleotide-diphosphate reductase subunit alpha

XFF4834R

lcl|nrdA-XALc_0161

46

832

S=3471 I=81 E=0

probable ribonucleoside-diphosphate reductase alpha subunit protein

Iprscan IPR000788 [PR01183]

369

388

Ribonucleotide reductase large subunit, C-terminal

Iprscan IPR000788 [PR01183]

512

523

Ribonucleotide reductase large subunit, C-terminal

Iprscan IPR000788 [PR01183]

573

596

Ribonucleotide reductase large subunit, C-terminal

Iprscan IPR000788 [PR01183]

611

633

Ribonucleotide reductase large subunit, C-terminal

Iprscan IPR000788 [PR01183]

639

662

Ribonucleotide reductase large subunit, C-terminal

Iprscan IPR000788 [PR01183]

700

727

Ribonucleotide reductase large subunit, C-terminal

Iprscan [G3DSA:1.10.40.20]

58

155

-

Iprscan [G3DSA:1.10.395.10]

162

271

-

Iprscan [G3DSA:3.90.244.10]

529

822

-

Iprscan [PTHR11573:SF7]

275

830

-

Iprscan IPR000788 [PTHR11573]

275

830

Ribonucleotide reductase large subunit, C-terminal

Iprscan IPR000788 [PF02867]

293

817

Ribonucleotide reductase large subunit, C-terminal

Iprscan IPR013509 [PF00317]

208

290

Ribonucleotide reductase large subunit, N-terminal

Iprscan IPR013346 [TIGR02506]

211

820

Ribonucleoside-diphosphate reductase, alpha subunit

Iprscan IPR000788 [PS00089]

689

711

Ribonucleotide reductase large subunit, C-terminal

Iprscan IPR005144 [PS51161]

62

155

ATP-cone

Iprscan [seg]

19

28

-

Iprscan [seg]

141

155

-

Iprscan [SSF51998]

293

822

-

Iprscan IPR008926 [SSF48168]

68

292

Ribonucleotide reductase R1 subunit, N-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Xn6QTgVX)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

211 hits
swiss-prot

Swiss-Prot ncbi-blastp

77 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

20 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr39410.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr39410.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr39410.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1gQZa8/XFF4834R_chr39410.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.