Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr04830speDXFF4834R_chr04830S-adenosylmethionine decarboxylase
  2. XFF4834R_chr16250XFF4834R_chr17500382_1879548_f1_XFF4834R-XFF4834R_chr16250XFF4834R_chr16250putative glutathionylspermidine synthase
  3. XFF4834R_chr38130speAXFF4834R_chr38130Arginine decarboxylase
  4. XFF4834R_chr38140speEXFF4834R_chr38140Spermidine synthase

speD XFF4834R_chr04830
XFF4834R_chr04820
XFF4834R_chr04820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04840
XFF4834R_chr04840
ID speD
AC XFF4834R_chr04830
LT XFF4834R_chr04830
OR XFF4834R_chr from 549449 to 550243 on strand +
DE S-adenosylmethionine decarboxylase
IP S-adenosylmethionine decarboxylase, bacterial/archaeal; S-adenosylmethionine decarboxylase, bacterial; S-adenosylmethionine decarboxylase, core
CL 1.7.14.3 Spermidine biosynthesis
EC
GO InterPro
Biological Process: spermidine biosynthetic process (GO:0008295)
Molecular Function: adenosylmethionine decarboxylase activity (GO:0004014)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120319)
MW 30805.8 Da
SQ 264 aa
 
........10........20........30........40........50
| | | | |
MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEQYDAD
RLTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVIDKKQAGKE
LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPLKAL
NYLIESLESDIVIMDYRVRGFTRDVKGKKHYIDHKINSIQQFLAKNVKSR
YEMFDVNVYQENIFHTKMHLKDFDLDQYLFEERAKNLSFKERMKIETLLK
REIEELFHGRNLSE
Show or not Domain decomposition
 
Hamap SPED_MF_00465 raw_score=10474 norm_score=52.224

S-adenosylmethionine decarboxylase proenzyme [speD].

XFF4834R

NP_640839.1 lcl|speD-XAC0484

1

264

S=1402 I=100 E=5.74587e-163

S-adenosylmethionine decarboxylase

XFF4834R

YP_362251.1 lcl|speD-XCV0520

1

264

S=1399 I=100 E=1.44786e-162

S-adenosylmethionine decarboxylase

XFF4834R

NP_635867.1 lcl|speD-XCC0473

1

264

S=1396 I=100 E=3.06454e-162

S-adenosylmethionine decarboxylase

XFF4834R

lcl|speD-XALc_0287

1

264

S=1328 I=94 E=5.75278e-154

probable s-adenosylmethionine decarboxylase protein

pubmed

1

264

S=1366 I=97 E=4.8574e-157

S-adenosyl methionine decarboxylase proenzyme ; Lyase Polyamine biosynthesis Pyruvate S-adenosyl-L-methionine Schiff base Spermidine

Pubmed 17574998

 

prodomImg

pubmed

1

264

S=1283 I=89 E=6.59312e-147

S-adenosylmethionine decarboxylase SpeD ; Lyase Polyamine biosynthesis Pyruvate S-adenosyl-L-methionine Schiff base Spermidine

Pubmed 15640196

 

prodomImg

pubmed

5

263

S=925 I=65 E=1.39406e-103

S-adenosylmethionine decarboxylase proenzyme EC=4.1.1.50 ; Lyase Polyamine biosynthesis Pyruvate S-adenosyl-L-methionine Schiff base Spermidine

Pubmed 11526206

 

prodomImg

pubmed

5

262

S=919 I=65 E=8.25521e-103

S-adenosylmethionine decarboxylase proenzyme EC=4.1.1.50 ; Allosteric Autocatalytic cleavage Lyase Magnesium Polyamine biosynthesis Pyruvate S-ad

Pubmed 3316212,8202364

 

prodomImg

pubmed

2

262

S=877 I=62 E=1.00463e-97

S-adenosylmethionine decarboxylase proenzyme EC=4.1.1.50 ; Autocatalytic cleavage Lyase Polyamine biosynthesis Pyruvate S-adenosyl-L-methionine Schiff b

Pubmed 18441057

 

prodomImg

sp_Pdown

sp|Q8PQ44|SPED_XANAC

1

264

S=1402 I=100 E=1.46823e-161

S-adenosylmethionine decarboxylase proenzyme EC=4.1.1.50 ; Autocatalytic cleavage Lyase Polyamine biosynthesis Pyruvate S-adenosyl-L-methionine Schiff b

sp_Pdown

sp|Q3BYB2|SPED_XANC5

1

264

S=1399 I=100 E=3.69968e-161

S-adenosylmethionine decarboxylase proenzyme EC=4.1.1.50 ; Autocatalytic cleavage Lyase Polyamine biosynthesis Pyruvate S-adenosyl-L-methionine Schiff b

sp_Pdown

sp|Q9X4I6|SPED_XANCP

1

264

S=1396 I=100 E=7.83076e-161

S-adenosylmethionine decarboxylase proenzyme EC=4.1.1.50 ; Autocatalytic cleavage Lyase Polyamine biosynthesis Pyruvate S-adenosyl-L-methionine Schiff b

sp_Pdown

sp|B0RN02|SPED_XANCB

1

264

S=1396 I=100 E=7.83076e-161

S-adenosylmethionine decarboxylase proenzyme EC=4.1.1.50 ; Autocatalytic cleavage Lyase Polyamine biosynthesis Pyruvate S-adenosyl-L-methionine Schiff b

sp_Pdown

sp|Q4UZF5|SPED_XANC8

1

264

S=1396 I=100 E=7.83076e-161

S-adenosylmethionine decarboxylase proenzyme EC=4.1.1.50 ; Autocatalytic cleavage Lyase Polyamine biosynthesis Pyruvate S-adenosyl-L-methionine Schiff b

Iprscan IPR016067 [G3DSA:3.60.90.10]

48

187

S-adenosylmethionine decarboxylase, core

Iprscan IPR009165 [PIRSF001356]

1

264

S-adenosylmethionine decarboxylase, bacterial

Iprscan IPR003826 [PF02675]

42

170

S-adenosylmethionine decarboxylase, bacterial/archaeal

Iprscan IPR009165 [TIGR03331]

7

262

S-adenosylmethionine decarboxylase, bacterial

PD123272

7

260

S=1061 I=76 E=4.73654e-121

Iprscan IPR016067 [SSF56276]

48

175

S-adenosylmethionine decarboxylase, core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4g5kALMZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

102 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr04830.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr04830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr04830.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr04830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr17500382_1879548_f1_XFF4834R-XFF4834R_chr16250 XFF4834R_chr16250
XFF4834R_chr16240
XFF4834R_chr16240
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16260
XFF4834R_chr16260
ID XFF4834R_chr17500382_1879548_f1_XFF4834R-XFF4834R_chr16250
AC XFF4834R_chr16250
LT XFF4834R_chr16250
OR XFF4834R_chr from 1878382 to 1879548 on strand +
DE putative glutathionylspermidine synthase
IP Glutathionylspermidine synthase
CL 1.7.14.3 Spermidine biosynthesis
EC
GO InterPro


Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110314)
MW 43600.7 Da
SQ 388 aa
 
........10........20........30........40........50
| | | | |
MQRILIPERADWRTQAESLGFHFHTIDGEPYWDESAYYAFSLRQIEDDIE
APTQELHDMAMQLVDEVVGSEALMTRLAIPPFYWDWIVNSWKERDPHLCG
RMDLAYSGDGPAKLYELNYDTPTSLYESAYFQWLWLEQQIASGALPKGTD
QYNLIQDLLCETLGALAVDGAIGAQMHFAAVRDSLEDRATVRYLRDCAHQ
VGISTEEVAIEDIGLSAEGWFTDEQDRVIHTLFKLYPLEFMMEERFGPAL
IADRVRLIEPAWKSVLSNKGILPLLWDRHQGHPNLLPARFAQAGEAPSAG
WVRKPLLSREGANIALVTAQGEAAHTDGPYVDGPAILQAHHPLPVFDGRH
ALVGSWVVADRPAGLGMRDDDGPITRDTSRFVPHVITD
XFF4834R

NP_643311.1 lcl|XAC3002-XAC3002

1

388

S=2026 I=99 E=0

synthetase/amidase

XFF4834R

YP_364883.1 lcl|XCV3152

1

388

S=2018 I=98 E=0

putative glutathionylspermidine synthase

XFF4834R

NP_638181.1 lcl|XCC2833

1

388

S=1929 I=93 E=0

synthetase/amidase

pubmed

1

388

S=987 I=48 E=6.87561e-111

Uncharacterized protein ygiC

Pubmed 1314093

 

prodomImg

pubmed

11

381

S=336 I=29 E=5.69703e-32

Trypanothione synthetase Trypanothione synthetase, putative

Pubmed 12826302

 

prodomImg

pubmed

11

382

S=333 I=28 E=1.35056e-31

Trypanothione synthetase Trypanothione synthetase, putative

Pubmed 12826302

 

prodomImg

pubmed

11

381

S=320 I=28 E=4.65408e-30

Trypanothione synthetase

Pubmed 12121990

 

prodomImg

pubmed

55

381

S=320 I=29 E=4.73594e-30

Trypanothione synthetase EC=6.3.1.9 ; ATP-binding Ligase Magnesium Nucleotide-binding

Pubmed 9677355,1304372

 

prodomImg

pubmed

55

381

S=316 I=28 E=1.37202e-29

Trypanothione synthetase

Pubmed 15537651

 

prodomImg

pubmed

55

381

S=308 I=28 E=1.5354e-28

Trypanothione synthetase EC=6.3.1.9 ; Ligase

Pubmed 15610825

 

prodomImg

pubmed

55

381

S=302 I=28 E=8.70436e-28

Trypanothione synthetase

Pubmed 18083246

 

prodomImg

pubmed

34

383

S=300 I=26 E=1.46868e-27

Trypanothione synthetase EC=6.3.1.9 ; Ligase

Pubmed 12967709

 

prodomImg

pubmed

55

381

S=297 I=27 E=2.97601e-27

Trypanothione synthetase

Pubmed 15610825

 

prodomImg

sp_Pdown

sp|P0ADT5|YGIC_ECOLI

1

388

S=987 I=48 E=4.73336e-111

Uncharacterized protein ygiC

sp_Pdown

sp|P0ADT6|YGIC_ECOL6

1

388

S=987 I=48 E=4.73336e-111

Uncharacterized protein ygiC

sp_Pdown

sp|P0ADT7|YGIC_ECO57

1

388

S=987 I=48 E=4.73336e-111

Uncharacterized protein ygiC

sp_Pdown

sp|P33222|YJFC_ECOLI

1

386

S=983 I=51 E=1.67576e-110

Uncharacterized protein yjfC

sp_Pdown

sp|P44940|Y929_HAEIN

1

387

S=603 I=37 E=1.64098e-64

Uncharacterized protein HI0929

Iprscan IPR005494 [PF03738]

3

387

Glutathionylspermidine synthase

PD597651

193

386

S=480 I=49 E=1.25207e-50

PD007794

1

169

S=414 I=50 E=1.32201e-42

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Wp01zdvR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

9 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr16250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr16250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr16250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr16250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
speA XFF4834R_chr38130
XFF4834R_chr_4053
XFF4834R_chr_4053
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38140
XFF4834R_chr38140
ID speA
AC XFF4834R_chr38130
LT XFF4834R_chr38130
OR XFF4834R_chr from 4406364 to 4408301 on strand -
DE Arginine decarboxylase
IP Orn/DAP/Arg decarboxylase 2
CL 1.7.14.3 Spermidine biosynthesis
EC
GO InterPro
Biological Process: spermidine biosynthetic process (GO:0008295)
Biological Process: arginine catabolic process (GO:0006527)
Molecular Function: arginine decarboxylase activity (GO:0008792)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN GenProtEC Metabolism --> Carbon compound utilization --> Amino acids --> Arginine degradation III (agmatinase pathway) Metabolism --> Central intermediary metabolism --> Polyamine biosynthesis --> Putrescine biosynthesis I Location of gene products --> Periplasmic space
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120410)
MW 70918.3 Da
SQ 645 aa
 
........10........20........30........40........50
| | | | |
MPGVTLHALFNSSRDSEMSDWSLDQARKTYSIPHWADGYFDVNAAGHVVV
TPTADGPAVSLPEVVDAARAAGAKLPLLVRFPDILGQRLGKLQAAFAQAQ
SEWDYAGGYTAVYPIKVNQHRGVAGTLASHHGEGFGLEAGSKPELMAVLA
LSRPGGLIVCNGYKDREYIRLALIGRKLGLQTFIVIEKPSELTLVLEEAR
ALDVKPGLGVRMRLASLGAGKWQNSGGDKAKFGLSPRQVLDLWKTLRDTE
YADSLNLLHFHMGSQISNVRDIANGMREATRYFVELSRLGAKISHVDVGG
GLGIDYEGTRSRSYCSINYGLHSYASNIVQPLASACEEHGLTPPRIVTEC
GRAMTAHHAVLIANVSEVEQAPEGRVPDAHDDEPAAIRHLREIHDELDVR
PAVELFQEAQHFHAEGLSAYALGQIDLTHRARIDDLFYAIAHGVRARLSF
DEKSHRPVLDELNERLVDKYFVNFSVFESIPDVWAIDQVFPIVPIERLNE
APLRRGIIADMTCDSDGMVKTYVENESLDSSLPLHRLNAGESYRIGFFLV
GAYQEILGDIHNLFGDTDAVEVVVDRDGYRIAQQRRGDTTDVMLDYVGYQ
LDTLRATYAERIAAAHLSPERAQELSAALEAGLTGYTYLSDEPLG
pubmed

7

642

S=1540 I=48 E=1.34394e-177

Biosynthetic arginine decarboxylase EC=4.1.1.19 ; Lyase Magnesium Metal-binding Periplasm Polyamine biosynthesis Putrescine Pyridoxal phosphate

Pubmed 2198270

 

prodomImg

pubmed

19

573

S=951 I=40 E=3.24768e-106

Arginine decarboxylase EC=4.1.1.19 ; Lyase Spermidine biosynthesis

Pubmed 16769692,13679984

 

prodomImg

pubmed

19

573

S=950 I=40 E=4.44516e-106

Arginine decarboxylase EC=4.1.1.19 ; Lyase Spermidine biosynthesis

Pubmed 16769692,13679984

 

prodomImg

pubmed

19

573

S=934 I=39 E=3.92782e-104

Arginine decarboxylase EC=4.1.1.19 ; Lyase Magnesium Putrescine biosynthesis Pyridoxal phosphate Spermidine

Pubmed 7548836

 

prodomImg

pubmed

16

572

S=918 I=40 E=2.91531e-102

Arginine decarboxylase EC=4.1.1.19 ; Lyase Spermidine biosynthesis

Pubmed 15723827

 

prodomImg

pubmed

21

572

S=917 I=39 E=4.91898e-102

Arginine decarboxylase EC=4.1.1.19 ; Lyase Spermidine biosynthesis

Pubmed 12060267

 

prodomImg

pubmed

21

573

S=915 I=39 E=7.87674e-102

Arginine decarboxylase 1 EC=4.1.1.19 ; Lyase Magnesium Putrescine biosynthesis Pyridoxal phosphate Spermidine

Pubmed 8756495

 

prodomImg

pubmed

20

632

S=903 I=37 E=2.44472e-100

Arginine decarboxylase EC=4.1.1.19 ; Lyase Spermidine biosynthesis

Pubmed 15527979

 

prodomImg

pubmed

35

359

S=896 I=53 E=1.66441e-99

Arginine decarboxylase EC=4.1.1.19 ; Lyase Spermidine biosynthesis

Pubmed 16318732

 

prodomImg

pubmed

35

359

S=894 I=53 E=2.31818e-99

Arginine decarboxylase EC=4.1.1.19 ; Lyase Spermidine biosynthesis

Pubmed 16318732

 

prodomImg

sp_Pdown

sp|Q8PFQ5|SPEA_XANAC

18

645

S=3318 I=100 E=0

Biosynthetic arginine decarboxylase EC=4.1.1.19 ; Lyase Magnesium Metal-binding Polyamine biosynthesis Pyridoxal phosphate Spermidine

sp_Pdown

sp|Q8P448|SPEA_XANCP

18

645

S=3172 I=97 E=0

Biosynthetic arginine decarboxylase EC=4.1.1.19 ; Lyase Magnesium Metal-binding Polyamine biosynthesis Pyridoxal phosphate Spermidine

sp_Pdown

sp|Q87F25|SPEA_XYLFT

21

644

S=2781 I=84 E=0

Biosynthetic arginine decarboxylase EC=4.1.1.19 ; Lyase Magnesium Metal-binding Polyamine biosynthesis Pyridoxal phosphate Spermidine

sp_Pdown

sp|B2I6M1|SPEA_XYLF2

21

644

S=2781 I=84 E=0

Biosynthetic arginine decarboxylase EC=4.1.1.19 ; Lyase Magnesium Metal-binding Polyamine biosynthesis Pyridoxal phosphate Spermidine

sp_Pdown

sp|Q9PH02|SPEA_XYLFA

21

644

S=2770 I=84 E=0

Biosynthetic arginine decarboxylase EC=4.1.1.19 ; Lyase Magnesium Metal-binding Polyamine biosynthesis Pyridoxal phosphate Spermidine

Iprscan IPR002985 [PR01180]

81

96

Arginine decarboxylase

Iprscan IPR002985 [PR01180]

105

119

Arginine decarboxylase

Iprscan IPR002985 [PR01180]

159

174

Arginine decarboxylase

Iprscan IPR002985 [PR01180]

185

206

Arginine decarboxylase

Iprscan IPR002985 [PR01180]

209

231

Arginine decarboxylase

Iprscan IPR002985 [PR01180]

336

353

Arginine decarboxylase

Iprscan IPR002985 [PR01180]

473

494

Arginine decarboxylase

Iprscan IPR002985 [PR01180]

498

523

Arginine decarboxylase

Iprscan IPR002985 [PR01180]

551

572

Arginine decarboxylase

Iprscan IPR000183 [PR01179]

113

131

Orn/DAP/Arg decarboxylase 2

Iprscan IPR000183 [PR01179]

136

148

Orn/DAP/Arg decarboxylase 2

Iprscan IPR000183 [PR01179]

252

265

Orn/DAP/Arg decarboxylase 2

Iprscan IPR000183 [PR01179]

346

365

Orn/DAP/Arg decarboxylase 2

Iprscan IPR000183 [PR01179]

551

564

Orn/DAP/Arg decarboxylase 2

Iprscan [G3DSA:3.20.20.10]

82

351

-

Iprscan IPR002985 [PIRSF001336]

21

642

Arginine decarboxylase

Iprscan IPR002985 [PTHR11482:SF3]

72

565

Arginine decarboxylase

Iprscan [PTHR11482]

72

565

-

Iprscan IPR000183 [PF02784]

94

357

Orn/DAP/Arg decarboxylase 2

Iprscan IPR000183 [PF00278]

360

572

Orn/DAP/Arg decarboxylase 2

Iprscan IPR002985 [TIGR01273]

21

640

Arginine decarboxylase

PD005416

467

582

S=404 I=59 E=2.22253e-41

PD862121

21

140

S=304 I=50 E=2.98554e-29

PDA1E4D8

308

453

S=239 I=39 E=2.12929e-21

PDA1F8M5

141

202

S=234 I=77 E=8.51703e-21

PDA1K8H5

204

230

S=143 I=100 E=1.08669e-09

PD706117

587

642

S=128 I=52 E=5.99652e-08

PDA52017

201

229

S=115 I=69 E=2.80381e-06

PDA52015

202

229

S=106 I=64 E=2.80147e-05

PDA2P3E5

202

230

S=106 I=55 E=3.03015e-05

PDA2P3E4

197

229

S=105 I=64 E=4.29462e-05

Iprscan [SSF51419]

81

359

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one V540QM5P)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

92 hits
swiss-prot

Swiss-Prot ncbi-blastp

110 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

22 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr38130.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr38130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr38130.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr38130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
speE XFF4834R_chr38140
XFF4834R_chr38130
XFF4834R_chr38130
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4056
XFF4834R_chr_4056
ID speE
AC XFF4834R_chr38140
LT XFF4834R_chr38140
OR XFF4834R_chr from 4408483 to 4409340 on strand +
DE Spermidine synthase
IP Spermine synthase
CL 1.7.14.3 Spermidine biosynthesis
EC
GO InterPro
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120410)
MW 31522.4 Da
SQ 285 aa
 
........10........20........30........40........50
| | | | |
MSANDNWYIEHFQPTGSAIGFRISGKLDEVQSPFQKIEIYQTTDWGKLML
IDGAVMLTSRDNFFYHEMISHPALFTHPAPKRVVIIGGGDCGTLREVLKH
PGVESATQCDIDEQVTRMSEKYFPELCDSNHDARAELLFNDGVAYMANCP
AGSVDIVIVDSTDPVGPAEGLFNKAFYESCFKALKDDGILVQQSESPLAL
LDLINEMRTEMGKAGFQSFKTLPFPQPCYPTGWWSVTMASKQADADFAFR
QDAAQAKGFDTLYYTAHQHTGVLVAPPFVAKALGE
Show or not Domain decomposition
 
pubmed

2

283

S=482 I=36 E=8.86678e-50

Probable spermidine synthase EC=2.5.1.16 ; Polyamine biosynthesis Transferase

Pubmed 18790866

 

prodomImg

pubmed

16

285

S=456 I=36 E=1.21058e-46

Spermidine synthase EC=2.5.1.16 ; biosynthesis Transferase

Pubmed 7803821

 

prodomImg

pubmed

7

280

S=454 I=38 E=1.77664e-46

Spermidine synthase EC=2.5.1.16 ; Polyamine biosynthesis Transferase

Pubmed 9353933

 

prodomImg

pubmed

7

284

S=452 I=35 E=3.32833e-46

Spermidine synthase EC=2.5.1.16 ; Polyamine biosynthesis Transferase

Pubmed 11731804

 

prodomImg

pubmed

16

285

S=451 I=35 E=4.80021e-46

Spermidine synthase EC=2.5.1.16 ; Polymorphism biosynthesis Transferase

Pubmed 2344393,2069720

 

prodomImg

pubmed

16

240

S=437 I=38 E=2.24444e-44

Spermidine synthase EC=2.5.1.16 ; Transferase

Pubmed 16088399

 

prodomImg

pubmed

2

284

S=436 I=33 E=2.76685e-44

SPEE_NEUCR Spermidine synthase (Putrescine aminopropyltransferase) (SPDSY) Spermidine synthase

Pubmed 12410837

 

prodomImg

pubmed

16

240

S=435 I=38 E=3.78703e-44

Spermidine synthase 2 EC=2.5.1.16 ; biosynthesis Transferase

Pubmed 10344199

 

prodomImg

pubmed

16

240

S=434 I=38 E=5.46176e-44

Spermidine synthase 1 EC=2.5.1.16 ; biosynthesis Transferase

Pubmed 9517003

 

prodomImg

pubmed

31

232

S=431 I=42 E=1.26135e-43

Putative spermidine synthase ; Transferase

Pubmed 18394889

 

prodomImg

sp_Pdown

sp|Q8PFQ4|SPEE_XANAC

1

285

S=1434 I=94 E=2.22406e-165

Spermidine synthase EC=2.5.1.16 ; Polyamine biosynthesis Transferase

sp_Pdown

sp|Q3BN93|SPEE_XANC5

1

285

S=1430 I=93 E=6.78921e-165

Spermidine synthase EC=2.5.1.16 ; Polyamine biosynthesis Transferase

sp_Pdown

sp|Q5H6E7|SPEE_XANOR

1

285

S=1412 I=92 E=1.08534e-162

Spermidine synthase EC=2.5.1.16 ; Polyamine biosynthesis Transferase

sp_Pdown

sp|B2SHF6|SPEE_XANOP

1

285

S=1412 I=92 E=1.08534e-162

Spermidine synthase EC=2.5.1.16 ; Polyamine biosynthesis Transferase

sp_Pdown

sp|Q2P928|SPEE_XANOM

1

285

S=1412 I=92 E=1.08534e-162

Spermidine synthase EC=2.5.1.16 ; Polyamine biosynthesis Transferase

Iprscan [G3DSA:2.30.140.10]

4

56

-

Iprscan [G3DSA:3.40.50.150]

57

283

-

Iprscan IPR001045 [PTHR11558]

7

285

Spermine synthase

Iprscan IPR001045 [PF01564]

9

243

Spermine synthase

Iprscan IPR001045 [TIGR00417]

7

278

Spermine synthase

Iprscan [seg]

242

256

-

PD002785

7

283

S=484 I=40 E=3.56181e-51

PDA1U0A5

233

285

S=146 I=55 E=3.10001e-10

Iprscan [SSF53335]

2

283

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one buh9Lr2R)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

80 hits
swiss-prot

Swiss-Prot ncbi-blastp

195 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr38140.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr38140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr38140.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBYwBg1Q/XFF4834R_chr38140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.