Xanthomonas fuscans subsp. fuscans

7 hits

  1. XFF4834R_chr02210iaaAXFF4834R_chr02210Asparaginase
  2. XFF4834R_chr15380XFF4834R_chr16530939_1772342_f3_XFF4834R-XFF4834R_chr15380XFF4834R_chr15380putative asparaginase
  3. XFF4834R_chr19310XFF4834R_chr_2211526_2212230_r1_XFF4834R-XFF4834R_chr19310XFF4834R_chr19310putative Asp/Glu racemase
  4. XFF4834R_chr23510argCXFF4834R_chr23510N-acetyl-gamma-glutamylphosphate reductase, NAD(P)-binding
  5. XFF4834R_chr23570argFXFF4834R_chr23570N-acetyl ornithine carbamoyltransferase
  6. XFF4834R_chr23700eutBXFF4834R_chr23700ethanolamine ammonia-lyase, large subunit, heavy chain
  7. XFF4834R_chr23710eutCXFF4834R_chr23710ethanolamine ammonia-lyase, small subunit (light chain)

iaaA XFF4834R_chr02210
XFF4834R_chr02200
XFF4834R_chr02200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02220
XFF4834R_chr02220
ID iaaA
AC XFF4834R_chr02210
LT XFF4834R_chr02210
OR XFF4834R_chr from 257453 to 258463 on strand +
DE Asparaginase
IP Peptidase T2, asparaginase 2
CL 1.7.13 Amino acid conversion GO:0006520
EC
GO InterPro
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 34971.4 Da
SQ 336 aa
 
........10........20........30........40........50
| | | | |
MIAKSARALCLSLSLLLIAGPVLAATPMLVIHGGAGVEKSSLSKDEQARE
AMRRALRAGHAVLQHGGSAVDAVAATITVLEDAPQFNAGRGAVFTHDGKN
ELDAAIMDGASGKAGAIAGVHTVKNPILLARSVMDRSKHVMLVGDGAEAF
AREQGITLVDPGYFRTDKRWQQLQKALKAEAGDRQAQAELDLETAKHFGT
VGALALDRDGHLAAGTSTGGMTNKRYGRVGDAPIIGAGTYANSQCAVSGT
GWGEFYIRAVAAYDICARMKYAGQSLQQAAETVIDQQIPKAGGDGGAIAL
DAQGNLAFPFTTEGMYRGWIGADGTAHVAIFKDETL
XFF4834R

XFF4834R_chr15380 lcl|XFF4834R_chr16530939_1772342_f3_XFF4834R-XFF4834R_chr15380

62

284

S=321 I=38 E=2.06623e-32

XFF4834R

NP_640604.1 lcl|ansA-XAC0248

28

336

S=1490 I=93 E=2.02303e-173

asparaginase

XFF4834R

YP_361985.1 lcl|XCV0254

25

336

S=1456 I=90 E=2.80826e-169

asparaginase precursor

XFF4834R

NP_635624.1 lcl|ansA-XCC0229

28

336

S=1451 I=91 E=1.13313e-168

asparaginase

XFF4834R

NP_638262.2 lcl|aspG-XCC2914

62

284

S=326 I=39 E=2.12231e-32

asparaginase

XFF4834R

YP_364953.1 lcl|XCV3222

62

288

S=325 I=39 E=2.6623e-32

asparaginase precursor

XFF4834R

NP_643401.2 lcl|aspG-XAC3092

62

288

S=321 I=39 E=8.41542e-32

asparaginase

XFF4834R

lcl|XALc_2229

62

284

S=314 I=38 E=6.76161e-31

putative asparaginase protein

pubmed

29

334

S=708 I=50 E=4.00868e-77

Putative asparaginase

Pubmed 16672512

 

prodomImg

pubmed

28

333

S=675 I=48 E=3.56719e-73

Isoaspartyl peptidase EC=3.4.19.5 ; Autocatalytic cleavage Hydrolase Protease

Pubmed 11325937

 

prodomImg

pubmed

28

335

S=612 I=44 E=1.54777e-65

Putative asparaginase

Pubmed 10223939,17317567

 

prodomImg

pubmed

29

334

S=558 I=40 E=5.35798e-59

Isoaspartyl peptidase/L-asparaginase 1 EC=3.4.19.5 ; Alternative splicing Autocatalytic cleavage Hydrolase Protease

Pubmed 7630960

 

prodomImg

pubmed

29

331

S=556 I=40 E=9.69357e-59

Isoaspartyl peptidase/L-asparaginase EC=3.4.19.5 ; Autocatalytic cleavage Hydrolase Protease

Pubmed 15265041,16725155

 

prodomImg

pubmed

29

331

S=555 I=40 E=1.30384e-58

Isoaspartyl peptidase/L-asparaginase EC=3.4.19.5 ; Autocatalytic cleavage Hydrolase Protease

Pubmed 1391778

 

prodomImg

pubmed

49

331

S=543 I=41 E=3.74136e-57

Isoaspartyl peptidase/L-asparaginase EC=3.4.19.5 ; Autocatalytic cleavage Hydrolase Protease

Pubmed 1377963

 

prodomImg

pubmed

29

332

S=513 I=37 E=1.82425e-53

L-asparaginase 2 EC=3.5.1.1 ; Hydrolase

Pubmed 16705405

 

prodomImg

pubmed

28

258

S=454 I=45 E=2.23575e-46

L-asparaginase EC=3.5.1.1 ; Cytoplasm Hydrolase

Pubmed 11984834,12753071

 

prodomImg

pubmed

26

335

S=447 I=37 E=1.87642e-45

L-asparaginase EC=3.5.1.1 ; Alternative splicing Cytoplasm Hydrolase

Pubmed 11984834,14654938

 

prodomImg

sp_Pdown

sp|P37595|IAAA_ECOLI

28

334

S=684 I=47 E=2.12015e-74

Isoaspartyl peptidase EC=3.4.19.5 ; Autocatalytic cleavage Hydrolase Protease

sp_Pdown

sp|Q7CQV5|IAAA_SALTY

28

333

S=675 I=48 E=2.45682e-73

Isoaspartyl peptidase EC=3.4.19.5 ; Autocatalytic cleavage Hydrolase Protease

sp_Pdown

sp|P50288|ASPG_LUPAL

29

331

S=560 I=39 E=2.51445e-59

Isoaspartyl peptidase/L-asparaginase EC=3.4.19.5 ; Autocatalytic cleavage Hydrolase Protease

Iprscan IPR000246 [PF01112]

25

335

Peptidase T2, asparaginase 2

Iprscan [seg]

3

24

-

Iprscan [seg]

291

304

-

Iprscan [tmhmm]

9

31

-

PD412181

52

319

S=640 I=51 E=4.57528e-70

PDA4H621

139

245

S=277 I=49 E=3.86957e-26

PDA9A888

29

177

S=178 I=31 E=3.69968e-14

PD840411

28

238

S=165 I=29 E=1.69997e-12

PD526666

27

144

S=156 I=33 E=1.82125e-11

PDA2B2I6

264

333

S=117 I=37 E=9.26819e-07

PD932517

258

329

S=106 I=31 E=2.37452e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1pGkYvgP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

21 hits
swiss-prot

Swiss-Prot ncbi-blastp

39 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr02210.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr02210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr02210.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr02210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr16530939_1772342_f3_XFF4834R-XFF4834R_chr15380 XFF4834R_chr15380
XFF4834R_chr15370
XFF4834R_chr15370
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15390
XFF4834R_chr15390
ID XFF4834R_chr16530939_1772342_f3_XFF4834R-XFF4834R_chr15380
AC XFF4834R_chr15380
LT XFF4834R_chr15380
OR XFF4834R_chr from 1770939 to 1772342 on strand +
DE putative asparaginase
IP Peptidase T2, asparaginase 2; Twin-arginine translocation pathway, signal sequence
CL 1.7.13 Amino acid conversion GO:0006520
EC
GO InterPro
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN classification according to GenProtEC for asparaginase
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 50312.1 Da
SQ 467 aa
 
........10........20........30........40........50
| | | | |
MAPLSRPGLHGRCSRRGRHDAERDRCLRAPGNSVVRQPTAWRCGTFQQRR
CIAGQARRDPCLSRARRSQPGKGCARIRIRQRRNKVYPHATLSHDGKLVP
HCAAARFRHGVIRMLQRRHFLKSATLGAIASGLAGWGARAQAAAGATPGM
RPTALPRGAARVISTWDFGVAANQEAWKILSSGGIALDAVEAGVRVPEAD
PNNPTVGLGGYPDRDGRVTLDACIMDHLGNCGAVASLEDVVHAISVARAV
MEKTPHVMLVGDGARQFAFEQGFPKTTLLTPSSEAAWKEWLKTSKYSPEA
NVENRAWRDAKLPGGKDNHDTIGMLALDTHGNLSGACTTSGMAWKMHGRV
GDSPIIGAGLYVDNEVGGATSTGVGEEVIRNVGSFAVVEMMRQGKLPADA
CREVVMRLIRRKPELTRTLQVGFLAMNKRGEVGAFAIQKGFSYAVCDAQR
QDLLVPGESHYTSEPAA
XFF4834R

XFF4834R_chr02210 lcl|iaaA-XFF4834R_chr02210

179

406

S=321 I=38 E=3.68603e-32

L-asparaginase

XFF4834R

YP_364953.1 lcl|XCV3222

114

467

S=1731 I=93 E=0

asparaginase precursor

XFF4834R

NP_643401.2 lcl|aspG-XAC3092

114

467

S=1730 I=93 E=0

asparaginase

XFF4834R

NP_638262.2 lcl|aspG-XCC2914

114

467

S=1638 I=88 E=0

asparaginase

XFF4834R

lcl|XALc_2229

114

467

S=1461 I=79 E=9.73469e-170

putative asparaginase protein

XFF4834R

NP_635624.1 lcl|ansA-XCC0229

179

406

S=327 I=39 E=2.34583e-32

asparaginase

XFF4834R

NP_640604.1 lcl|ansA-XAC0248

179

406

S=321 I=38 E=1.4013e-31

asparaginase

XFF4834R

YP_361985.1 lcl|XCV0254

179

406

S=318 I=39 E=2.64817e-31

asparaginase precursor

XFF4834R

NP_643403.1 lcl|XAC3094-XAC3094

34

76

S=147 I=72 E=1.58306e-10

hypothetical protein

pubmed

162

457

S=955 I=62 E=7.93071e-107

N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase EC=3.5.1.26 ; Hydrolase Periplasm Signal

Pubmed 7840643,8250923

 

prodomImg

pubmed

162

455

S=502 I=41 E=4.94113e-52

N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase EC=3.5.1.26 ; Disulfide bond Glycoprotein Hydrolase Lysosome

Pubmed 8877373

 

prodomImg

pubmed

162

451

S=407 I=36 E=2.01025e-40

N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase EC=3.5.1.26 ; Disease mutation Disulfide bond Glycoprotein Hydrolase Lysosome Polymorphism Signal

Pubmed 2401370,2265705

 

prodomImg

pubmed

162

415

S=384 I=41 E=1.27428e-37

N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase EC=3.5.1.26 ; Disulfide bond Glycoprotein Hydrolase Lysosome Signal

Pubmed 2775174

 

prodomImg

pubmed

162

415

S=380 I=40 E=3.69163e-37

N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase EC=3.5.1.26 ; Disulfide bond Glycoprotein Hydrolase Lysosome Signal

Pubmed 8586423

 

prodomImg

pubmed

174

432

S=367 I=38 E=1.376e-35

Isoaspartyl peptidase EC=3.4.19.5 ; Autocatalytic cleavage Hydrolase Protease

Pubmed 11325937

 

prodomImg

pubmed

169

431

S=346 I=38 E=4.53569e-33

L-asparaginase EC=3.5.1.1 ; Cytoplasm Hydrolase

Pubmed 11984834,12753071

 

prodomImg

pubmed

187

432

S=317 I=35 E=1.28806e-29

Isoaspartyl peptidase/L-asparaginase EC=3.4.19.5 ; Autocatalytic cleavage Hydrolase Protease

Pubmed 15265041,16725155

 

prodomImg

pubmed

171

459

S=303 I=34 E=8.10076e-28

Putative asparaginase

Pubmed 10223939,17317567

 

prodomImg

pubmed

177

400

S=298 I=38 E=2.89305e-27

L-asparaginase EC=3.5.1.1 ; Alternative splicing Cytoplasm Hydrolase

Pubmed 11984834,14654938

 

prodomImg

sp_Pdown

sp|Q47898|ASPG_ELIMR

162

457

S=955 I=62 E=5.45744e-107

N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase EC=3.5.1.26 ; Hydrolase Periplasm Signal

sp_Pdown

sp|O02467|ASPG_SPOFR

162

455

S=502 I=41 E=3.40019e-52

N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase EC=3.5.1.26 ; Disulfide bond Glycoprotein Hydrolase Lysosome

Iprscan IPR000246 [PF01112]

162

441

Peptidase T2, asparaginase 2

Iprscan IPR006311 [TIGR01409]

115

140

Twin-arginine translocation pathway, signal sequence

Iprscan [seg]

132

149

-

PD412181

164

457

S=502 I=43 E=2.91377e-53

PDA7W471

68

113

S=169 I=67 E=5.51454e-13

PDA4H621

256

365

S=147 I=35 E=2.64457e-10

PD633218

34

76

S=147 I=72 E=3.04046e-10

PDA2U930

114

163

S=120 I=58 E=5.29892e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QzC7JQgJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

21 hits
swiss-prot

Swiss-Prot ncbi-blastp

38 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr15380.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr15380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr15380.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr15380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_2211526_2212230_r1_XFF4834R-XFF4834R_chr19310 XFF4834R_chr19310
XFF4834R_chr_4662
XFF4834R_chr_4662
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19320
XFF4834R_chr19320
ID XFF4834R_chr_2211526_2212230_r1_XFF4834R-XFF4834R_chr19310
AC XFF4834R_chr19310
LT XFF4834R_chr19310
OR XFF4834R_chr from 2211526 to 2212230 on strand -
DE putative Asp/Glu racemase
IP Aspartate racemase; Asp/Glu/hydantoin racemase
CL 1.7.13 Amino acid conversion GO:0006520
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: cellular amino acid metabolic process (GO:0006520)
acting on amino acids and derivatives (GO:0016855)

Curated
PM
AN CL: also 1.6.7 Peptidoglycan (murein) : Aspartate racemase (EC:5.1.1.13) and glutamate racemase (EC:5.1.1.3) are two evolutionary related bacterial enzymes that do not seem to require a cofactor for their activity [1]. Glutamate racemase, which interconverts L-glutamate into D-glutamate, is required for the biosynthesis of peptidoglycan and some peptide-based antibiotics such as gramicidin S.
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100825)
MW 25068.6 Da
SQ 234 aa
 
........10........20........30........40........50
| | | | |
MPVPSMTIGLIGGMSWESTLPYYRIINQRVRHACGGLHSAKLLLYSVNFH
EIERLQHTGDWDGAGQAMAAAARALQAAGADFIVLCTNTMHCVADAITAA
TPLPLLHIADATADALVAAGISRIGLLGTRFTMEQPFYRQRLQARGPDVL
VPPAEARAQLHRVIYDELCQGVIKPESRQYVCQVMTELGQHGAQAIILGC
TEISLLVDSTDAQLPLFDTTALHAEAAALASLSG
XFF4834R

YP_363563.1 XCV1832

1

220

S=961 I=83 E=1.35195e-109

putative aspartate racemase

XFF4834R

NP_642129.1 ygeA-XAC1802

1

220

S=947 I=83 E=7.26766e-108

putative resistance protein

XFF4834R

NP_637151.1 ygeA-XCC1785

1

220

S=916 I=79 E=3.73396e-104

putative resistance protein

pubmed

7

219

S=549 I=49 E=5.44101e-58

Uncharacterized protein ygeA ; Isomerase

Pubmed 6350602,2836407

 

prodomImg

pubmed

8

220

S=472 I=44 E=9.68526e-49

Aspartate racemase

Pubmed 8318541,8086457

 

prodomImg

pubmed

8

220

S=269 I=30 E=4.07149e-24

Putative aminoacid racemase Orfc372-4

Pubmed 12618374

 

prodomImg

pubmed

30

170

S=217 I=33 E=9.03516e-18

LysA activator protein

Pubmed 9020051

 

prodomImg

pubmed

81

218

S=178 I=28 E=3.96452e-13

228aa long hypothetical aspartate racemase

Pubmed 12051922

 

prodomImg

sp_Pdown

acc=P03813

7

219

S=549 I=49 E=3.71278e-58

Uncharacterized protein ygeA ; Isomerase

sp_Pdown

acc=P29079

81

218

S=145 I=26 E=2.81639e-09

Aspartate racemase EC=5.1.1.13 ; Isomerase

sp_Pdown

acc=P32960

8

220

S=131 I=23 E=1.47491e-07

Probable amino-acid racemase EC=5.1.1.- ; Cell shape wall biogenesis/degradation Isomerase Peptidoglycan synthesis Sporulation

Iprscan IPR001920 [G3DSA:3.40.50.1860]

110

234

Asp/Glu racemase

Iprscan IPR015942 [PF01177]

11

227

Asp/Glu/hydantoin racemase

Iprscan IPR004380 [TIGR00035]

4

234

Aspartate racemase

Iprscan IPR018187 [PS00924]

196

206

Asp/Glu racemase, active site

Iprscan [seg]

63

80

-

Iprscan [seg]

109

119

-

Iprscan [seg]

221

233

-

PDA1F9U0

124

179

S=201 I=63 E=6.09043e-17

PD355676

35

124

S=183 I=44 E=9.73629e-15

PD797741

120

218

S=117 I=24 E=1.11193e-06

PD434072

8

35

S=106 I=68 E=2.49953e-05

PDA3C2S1

91

220

S=105 I=28 E=3.10829e-05

Iprscan IPR001920 [SSF53681]

5

120

Asp/Glu racemase

Iprscan IPR001920 [SSF53681]

108

219

Asp/Glu racemase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xTiMoinA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr19310.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr19310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr19310.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr19310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
argC XFF4834R_chr23510
XFF4834R_chr23500
XFF4834R_chr23500
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23520
XFF4834R_chr23520
ID argC
AC XFF4834R_chr23510
LT XFF4834R_chr23510
OR XFF4834R_chr from 2721861 to 2722811 on strand -
DE N-acetyl-gamma-glutamylphosphate reductase, NAD(P)-binding
IP Semialdehyde dehydrogenase, NAD-binding; N-acetyl-gamma-glutamyl-phosphate reductase; Semialdehyde dehydrogenase, dimerisation region
CL 1.7.13 Amino acid conversion GO:0006520
EC
GO InterPro
Biological Process: cellular amino acid biosynthetic process (GO:0008652)
Biological Process: arginine biosynthetic process (GO:0006526)
Biological Process: cellular amino acid metabolic process (GO:0006520)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: N-acetyl-gamma-glutamyl-phosphate reductase activity (GO:0003942)
Molecular Function: protein dimerization activity (GO:0046983)
Molecular Function: NAD or NADH binding (GO:0051287)
NAD or NADP as acceptor (GO:0016620)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 34213.8 Da
SQ 316 aa
 
........10........20........30........40........50
| | | | |
MTVQPKTIGIVGARGHTGSELIKLVAAHPQLQLSFVSSRELAGQRVAEHN
DAYQGELRYENLDADAVAVKAADVVILALPNGKAAPFVAAIDAATPQTLV
IDLSADYRFDPAWYYGLPELTRGSYAGQRRISNPGCYATAMQLTIAPLLD
QLAGPPQCFGVSGYSGAGTTPSDKNNPELLSNNLMPYALTNHMHEREVSA
QLGVPVEFMPHVAPHFRGITMTVNLWLQQPLTREQIQARYTQRYADEPLI
EIVDEAPWVSRIAGKHGVQIGGITLAPGNKRVVVVATLDNMLKGAATQAM
QNLNLALGWDELMAIR
Show or not Domain decomposition
 
Hamap ARGC_MF_00150 raw_score=5367 norm_score=30.789

N-acetyl-gamma-glutamyl-phosphate reductase [argC].

XFF4834R

NP_642662.1 lcl|argC-XAC2346

1

316

S=1556 I=93 E=0

N-acetyl-gamma-glutamyl-phosphate reductase

XFF4834R

YP_364276.1 lcl|argC-XCV2545

1

316

S=1517 I=91 E=8.46478e-177

N-acetyl-gamma-glutamyl-phosphate reductase

XFF4834R

NP_637598.1 lcl|argC-XCC2243

1

315

S=1417 I=84 E=1.09811e-164

N-acetyl-gamma-glutamyl-phosphate reductase

XFF4834R

lcl|argC-XALc_1890

1

315

S=1258 I=73 E=2.51794e-145

probable n-acetyl-gamma-glutamyl phosphate reductase, nad(p)-binding protein

pubmed

4

315

S=800 I=50 E=2.68683e-88

Protein arg-6, mitochondrial EC=1.2.1.38 EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Kinase Mitochondrion Multifunctional enzyme

Pubmed 7907589

 

prodomImg

pubmed

4

315

S=779 I=50 E=1.04523e-85

Protein ARG5,6, mitochondrial EC=1.2.1.38 EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Kinase Mitochondrion Multifunctional enzyme NADP

Pubmed 9043106

 

prodomImg

pubmed

1

315

S=767 I=46 E=2.70132e-84

Protein arg11, mitochondrial EC=1.2.1.38 EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Cleavage pair of basic residues Kinase Mi

Pubmed 1313366

 

prodomImg

pubmed

1

315

S=722 I=46 E=7.08052e-79

Protein ARG5,6, mitochondrial EC=1.2.1.38 EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Kinase Mitochondrion Multifunctional enzyme

Pubmed 1851947

 

prodomImg

pubmed

8

311

S=407 I=34 E=9.80687e-41

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

Pubmed 16857943

 

prodomImg

pubmed

8

315

S=371 I=30 E=2.78266e-36

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

Pubmed 17563350

 

prodomImg

pubmed

9

304

S=340 I=33 E=1.29892e-32

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

Pubmed 19077236

 

prodomImg

pubmed

10

315

S=338 I=32 E=2.63203e-32

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

Pubmed 18441057

 

prodomImg

pubmed

10

311

S=320 I=30 E=4.06341e-30

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

Pubmed 8180696

 

prodomImg

pubmed

8

311

S=318 I=30 E=7.28763e-30

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

Pubmed 10931207

 

prodomImg

sp_Pdown

sp|Q8PK31|ARGC_XANAC

1

316

S=1556 I=93 E=4.19158e-180

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

sp_Pdown

sp|Q3BSI7|ARGC_XANC5

1

316

S=1517 I=91 E=2.20876e-175

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

sp_Pdown

sp|Q2P2F6|ARGC_XANOM

1

315

S=1479 I=89 E=1.03017e-170

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

sp_Pdown

sp|B0RS54|ARGC_XANCB

1

315

S=1429 I=85 E=1.23098e-164

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

sp_Pdown

sp|Q8P8J8|ARGC_XANCP

1

315

S=1417 I=84 E=2.86536e-163

N-acetyl-gamma-glutamyl-phosphate reductase EC=1.2.1.38 ; Amino-acid biosynthesis Arginine Cytoplasm NADP Oxidoreductase

Iprscan [MF_00150]

6

316

-

Iprscan IPR000534 [PF01118]

7

128

Semialdehyde dehydrogenase, NAD-binding

Iprscan IPR012280 [PF02774]

145

293

Semialdehyde dehydrogenase, dimerisation region

Iprscan IPR000534 [SM00859]

7

128

Semialdehyde dehydrogenase, NAD-binding

Iprscan IPR000706 [TIGR01850]

6

316

N-acetyl-gamma-glutamyl-phosphate reductase

Iprscan IPR000706 [PS01224]

131

147

N-acetyl-gamma-glutamyl-phosphate reductase

Iprscan [seg]

62

79

-

PD003765

162

315

S=252 I=39 E=5.10783e-23

PDA809O0

33

85

S=140 I=57 E=1.59713e-09

PDA1H1L0

86

118

S=124 I=67 E=1.36288e-07

PDA8F7A0

100

155

S=115 I=39 E=2.01599e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hb9ZtheQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

44 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23510.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23510.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
argF XFF4834R_chr23570
XFF4834R_chr23560
XFF4834R_chr23560
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23580
XFF4834R_chr23580
ID argF
AC XFF4834R_chr23570
LT XFF4834R_chr23570
OR XFF4834R_chr from 2727925 to 2728950 on strand -
DE N-acetyl ornithine carbamoyltransferase
IP Aspartate/ornithine carbamoyltransferase, Asp/Orn-binding region; Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding
CL 1.7.13 Amino acid conversion GO:0006520
EC
GO InterPro
Biological Process: cellular amino acid metabolic process (GO:0006520)
Molecular Function: carboxyl- or carbamoyltransferase activity (GO:0016743)
Molecular Function: amino acid binding (GO:0016597)

Curated
PM
AN chgt nom cf publi fonctionnel chez Xcc
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 38065.1 Da
SQ 341 aa
 
........10........20........30........40........50
| | | | |
MSLKHFLNTQDWSRAELDALLTQAALFKRNKLGSELKGKSIALVFFNPSM
RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVAR
VLGRYVDLIGVRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPC
QELAHALALQEHFGTQDLRGKKYVLTWTYHPKPLNTAVANSALTIATRMG
MDVTLLCPTPDYILDQRYMDWAAQNVAESGGSLQVSHDIDSAYAGADVVY
AKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGVFSHCLPLRRN
VKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVGQGSRDS
XFF4834R

YP_364282.1 lcl|argF-XCV2551

1

340

S=1810 I=98 E=0

N-acetylornithine carbamoyltransferase

XFF4834R

NP_637604.1 lcl|argF-XCC2249

1

336

S=1807 I=99 E=0

N-acetylornithine carbamoyltransferase

XFF4834R

NP_642668.1 lcl|argF-XAC2352

1

337

S=1805 I=99 E=0

N-acetylornithine carbamoyltransferase

XFF4834R

lcl|argF-XALc_1896

1

341

S=1754 I=94 E=0

probable ornithine carbamoyltransferase, chain f protein

XFF4834R

lcl|PyrB-XALc_2155

3

335

S=126 I=25 E=3.30765e-08

putative aspartate carbamoyltransferase, catalytic subunit protein

pubmed

1

336

S=1807 I=99 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 15731101

 

prodomImg

pubmed

3

334

S=476 I=36 E=4.84331e-49

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 12095263

 

prodomImg

pubmed

4

335

S=451 I=38 E=6.3859e-46

Ornithine carbamoyltransferase EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 9288929,9288930

 

prodomImg

pubmed

3

334

S=446 I=32 E=2.12696e-45

Putative ornithine carbamoyltransferase

Pubmed 18048332

 

prodomImg

pubmed

3

330

S=401 I=34 E=6.75385e-40

Ornithine carbamoyltransferase EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 17563350

 

prodomImg

pubmed

3

335

S=386 I=36 E=3.85913e-38

Ornithine carbamoyltransferase, chloroplastic EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Plastid Transit peptide

Pubmed 10561504

 

prodomImg

pubmed

36

335

S=360 I=36 E=5.9012e-35

Ornithine carbamoyltransferase EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 17350933

 

prodomImg

pubmed

3

336

S=356 I=33 E=1.72457e-34

Ornithine carbamoyltransferase, chloroplastic EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Plastid Transit peptide

Pubmed 8914525

 

prodomImg

pubmed

4

337

S=352 I=33 E=5.64476e-34

Ornithine carbamoyltransferase EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 2117745,8025667

 

prodomImg

pubmed

4

336

S=352 I=31 E=5.89628e-34

Ornithine carbamoyltransferase EC=2.1.3.3 Ornithine carbamoyltransferase OOCT1

Pubmed 10987149

 

prodomImg

sp_Pdown

sp|Q8P8J2|AOTC_XANCP

1

336

S=1807 I=99 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

sp_Pdown

sp|Q8PK25|AOTC_XANAC

1

337

S=1805 I=99 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

sp_Pdown

sp|Q87EL4|AOTC_XYLFT

1

336

S=1571 I=84 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

sp_Pdown

sp|Q9PEN0|AOTC_XYLFA

1

336

S=1567 I=84 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

sp_Pdown

sp|Q8A1E9|AOTC_BACTN

3

334

S=476 I=36 E=3.33515e-49

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

Iprscan [G3DSA:3.40.50.1370]

3

149

-

Iprscan [G3DSA:3.40.50.1370]

151

336

-

Iprscan IPR006132 [PF02729]

4

162

Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding

Iprscan IPR006131 [PF00185]

187

333

Aspartate/ornithine carbamoyltransferase, Asp/Orn-binding region

PD816676

143

261

S=359 I=57 E=5.3049e-36

PD919839

74

142

S=282 I=75 E=9.86373e-27

PD000708

4

76

S=150 I=41 E=1.05273e-10

PD409592

282

335

S=112 I=42 E=4.12428e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one m4Ds3OB7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

120 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23570.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23570.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
eutB XFF4834R_chr23700
XFF4834R_chr23690
XFF4834R_chr23690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23710
XFF4834R_chr23710
ID eutB
AC XFF4834R_chr23700
LT XFF4834R_chr23700
OR XFF4834R_chr from 2739221 to 2740630 on strand +
DE ethanolamine ammonia-lyase, large subunit, heavy chain
IP Ethanolamine ammonia lyase large subunit
CL 1.7.13 Amino acid conversion GO:0006520
EC
GO InterPro
Biological Process: cellular amino acid metabolic process (GO:0006520)
Molecular Function: ethanolamine ammonia-lyase activity (GO:0008851)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 50136.5 Da
SQ 469 aa
 
........10........20........30........40........50
| | | | |
MSGFAFTAGGERFRFADLKQLLAKATPARSGDQLAGLAADSGLQRVAAQM
ALADLPLQHFLQEAVVPYEADEVTRLIIDQHDAAAFAAVAHLTVGGFRDW
LLSAQADEAALTALAPGLTPEMVAAVSKLMRVQDLILVAQKTRVVTCFRN
TLGLRGRLSTRLQPNHPTDDATGIAASVLDGLLYGNGDAVIGINPASDSL
AATTALLRMLDAVISGYRIPTQSCVLAHITTTIEAIGRGVPVDLVFQSIA
GTEAANASFGINLALLQEGYEAGLSLRRGSVGDNVMYFETGQGSALSANA
HHGVDQQTCEVRAYAVARHYKPLLVNTVVGFIGPEYLYDGKQIIRAGLED
HFCGKLLGVPMGCDICYTNHAEADQDDMDMLLTLLGTAGINFIMGIPGSD
DVMLNYQTTSFHDALYARQALGLRAAPEFEQWLEQHDILQLRDGRFELGS
EVPAPFRRALAQVSGRTTP
XFF4834R

NP_642681.1 lcl|eutA-XAC2365

1

469

S=2040 I=84 E=0

ethanolamine ammonia-lyase large subunit

XFF4834R

YP_364294.1 lcl|eutA-XCV2563

1

469

S=2013 I=83 E=0

ethanolamine ammonia-lyase, large subunit

XFF4834R

NP_637615.1 lcl|eutA-XCC2260

1

463

S=1854 I=78 E=0

ethanolamine ammonia-lyase large subunit

pubmed

4

446

S=1297 I=57 E=2.41345e-148

Riorf58 protein ; Plasmid

Pubmed 10907845,11273700

 

prodomImg

pubmed

1

435

S=1279 I=58 E=4.59319e-146

Ethanolamine ammonia-lyase large subunit EC=4.3.1.7

Pubmed 7836301,8069783

 

prodomImg

pubmed

10

456

S=970 I=45 E=1.11245e-108

Ethanolamine ammonia-lyase heavy chain EC=4.3.1.7 ; Cobalamin Cobalt

Pubmed 2197274,10464203

 

prodomImg

sp_Pdown

sp|P0AEJ6|EUTB_ECOLI

10

456

S=971 I=45 E=5.69117e-109

Ethanolamine ammonia-lyase heavy chain EC=4.3.1.7 ; Cobalt

sp_Pdown

sp|P0AEJ7|EUTB_ECO57

10

456

S=971 I=45 E=5.69117e-109

Ethanolamine ammonia-lyase heavy chain EC=4.3.1.7 ; Cobalt

sp_Pdown

sp|P19264|EUTB_SALTY

10

456

S=970 I=45 E=7.65495e-109

Ethanolamine ammonia-lyase heavy chain EC=4.3.1.7 ; Cobalamin Cobalt

Iprscan IPR010628 [PIRSF018788]

2

461

Ethanolamine ammonia lyase large subunit

Iprscan IPR010628 [PF06751]

12

456

Ethanolamine ammonia lyase large subunit

Iprscan [seg]

83

90

-

Iprscan [seg]

102

120

-

Iprscan [seg]

149

162

-

Iprscan [seg]

200

207

-

Iprscan [seg]

373

389

-

PDA1G1M5

163

424

S=1042 I=76 E=1.08617e-118

PD025217

34

145

S=293 I=56 E=5.28073e-28

PDA1G2B7

34

82

S=170 I=67 E=4.99254e-13

PD574787

426

464

S=121 I=59 E=4.32077e-07

PDA1G924

3

33

S=112 I=68 E=4.43157e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FlAAAWi4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23700.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23700.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
eutC XFF4834R_chr23710
XFF4834R_chr23700
XFF4834R_chr23700
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23720
XFF4834R_chr23720
ID eutC
AC XFF4834R_chr23710
LT XFF4834R_chr23710
OR XFF4834R_chr from 2740627 to 2741442 on strand +
DE ethanolamine ammonia-lyase, small subunit (light chain)
IP Ethanolamine ammonia-lyase light chain
CL 1.7.13 Amino acid conversion GO:0006520
EC
GO InterPro
Biological Process: cellular amino acid metabolic process (GO:0006520)
Molecular Function: ethanolamine ammonia-lyase activity (GO:0008851)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 29105.8 Da
SQ 271 aa
 
........10........20........30........40........50
| | | | |
MSTPSRPPRDAWAQLRQLTPARIALGRVGTSLPTDAHLEFQLAHAQARDA
VHLAFDPAPLQAALEQRGRSSILLQSAAADRHQYLQRPDLGRRLAEEAAA
QLRGLTAVHGGRHDVAVVVADGLSALAVHRHAARMLDQIDALASQEGWSL
APVVLVRQGRVAIGDEVGELLDARAVIVLIGERPGLSSPDSLGLYLTYTP
RVGLTDAARNCISNIRAEGLSYAEAAHKLGYLLREAFRRKLSGVQLKDEA
EQPALLAGPANVAPRTFLLPD
Hamap EUTC_MF_00601 raw_score=6492 norm_score=41.323

Ethanolamine ammonia-lyase light chain [eutC].

XFF4834R

NP_642682.1 lcl|eutC-XAC2366

1

271

S=1249 I=92 E=2.04256e-144

ethanolamine ammonia-lyase small subunit

XFF4834R

YP_364295.1 lcl|eutC-XCV2564

26

271

S=1076 I=88 E=2.04236e-123

ethanolamine ammonia-lyase small subunit

XFF4834R

NP_637616.1 lcl|eutC-XCC2261

1

271

S=1061 I=79 E=1.56968e-121

ethanolamine ammonia-lyase small subunit

pubmed

9

257

S=495 I=48 E=2.09418e-51

Riorf57 protein ; Plasmid

Pubmed 10907845,11273700

 

prodomImg

pubmed

1

258

S=385 I=40 E=3.61939e-38

Ethanolamine ammonia-lyase light chain EC=4.3.1.7 ; Cobalamin Cobalt

Pubmed 8069783

 

prodomImg

pubmed

10

246

S=300 I=35 E=8.96585e-28

Ethanolamine ammonia-lyase light chain EC=4.3.1.7 ; Cobalamin Cobalt

Pubmed 2197274,10464203

 

prodomImg

sp_Pdown

sp|Q8PK11|EUTC_XANAC

1

271

S=1249 I=92 E=5.23795e-143

Ethanolamine ammonia-lyase light chain EC=4.3.1.7 ; Cobalamin Cobalt

sp_Pdown

sp|Q8P8I0|EUTC_XANCP

1

271

S=1061 I=79 E=4.02529e-120

Ethanolamine ammonia-lyase light chain EC=4.3.1.7 ; Cobalamin Cobalt

sp_Pdown

sp|B0RS35|EUTC_XANCB

1

271

S=1051 I=78 E=5.60173e-119

Ethanolamine ammonia-lyase light chain EC=4.3.1.7 ; Cobalamin Cobalt

sp_Pdown

sp|Q4UVK6|EUTC_XANC8

1

271

S=1051 I=78 E=5.60173e-119

Ethanolamine ammonia-lyase light chain EC=4.3.1.7 ; Cobalamin Cobalt

sp_Pdown

sp|B0KL94|EUTC_PSEPG

3

269

S=807 I=63 E=1.98704e-89

Ethanolamine ammonia-lyase light chain EC=4.3.1.7 ; Cobalamin Cobalt

Iprscan [MF_00601]

2

247

-

Iprscan IPR009246 [PIRSF018982]

1

265

Ethanolamine ammonia-lyase light chain

Iprscan IPR009246 [PF05985]

5

247

Ethanolamine ammonia-lyase light chain

Iprscan [seg]

90

105

-

PD667617

135

271

S=471 I=71 E=1.35011e-49

PD023880

12

133

S=310 I=56 E=3.91747e-30

PDA1J6M5

148

173

S=108 I=81 E=1.3243e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one IaP5Acau)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

67 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23710.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23710.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGpJ5rL/XFF4834R_chr23710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.