Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr07220nagBIIXFF4834R_chr07220glucosamine-6-phosphate deaminase, probable

nagBII XFF4834R_chr07220
XFF4834R_chr07210
XFF4834R_chr07210
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07230
XFF4834R_chr07230
ID nagBII
AC XFF4834R_chr07220
LT XFF4834R_chr07220
OR XFF4834R_chr from 831889 to 832917 on strand +
DE glucosamine-6-phosphate deaminase, probable
IP Sugar isomerase (SIS)
CL 1.7.12 Amino sugar conversions GO:0046349
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: sugar binding (GO:0005529)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120426)
MW 35375 Da
SQ 342 aa
 
........10........20........30........40........50
| | | | |
MSLPSDTETLMFREAAQTADVVAAQFARNADTIAALAQSLRETPPPFVVT
CARGSSDHAATYAKYLFETQLGIVTASASPSVGSVYAAPLQLRGALYIVI
SQSGKSPDLLRNAEAAKAAGARVVALVNVEDSPLAQLAEVVIPLGAGPEK
SVAATKSYLASLAAVLHLGAVWKNDPALLAALDALPQQLRSALQADWSAL
TAGLVPAHNLFVLGRGLGLGAAQEAALKFKETCGLHAEAYSSAEVKHGPM
ALVGPGFPVLVFAQPDETGAGTRALAEEFRARGAQVWLAAPGGDLPLAEA
AHPACAPLLTVQSFYRAINALALQRGNNPDLPPHLNKVTETV
XFF4834R

XFF4834R_chr35330 lcl|glmS-XFF4834R_chr35330

228

290

S=131 I=43 E=2.53288e-09

L-glutamine:D-fructose-6-phosphate aminotransferase

XFF4834R

YP_362501.1 lcl|glmS-XCV0770

1

342

S=1475 I=86 E=1.21408e-171

glucosamine-6-phosphate deaminase

XFF4834R

NP_641067.2 lcl|glmS-XAC0714

1

342

S=1475 I=85 E=1.27928e-171

glucosamine-fructose-6-phosphate aminotransferase

XFF4834R

NP_638757.2 lcl|glmS-XCC3411

1

342

S=1431 I=83 E=2.4713e-166

glucosamine-fructose-6-phosphateaminotransferase

XFF4834R

lcl|nagB-II-XALc_0840

1

342

S=1207 I=73 E=3.60838e-139

putative glucosamine-6-phosphate deaminase protein

XFF4834R

YP_365485.1 lcl|glmS-XCV3754

40

290

S=154 I=26 E=1.65703e-11

D-fructose-6-phosphate amidotransferase

XFF4834R

NP_643944.1 lcl|glmS-XAC3637

40

290

S=149 I=26 E=6.68605e-11

D-fructose-6-phosphate amidotransferase

XFF4834R

lcl|glmS-XALc_2893

54

337

S=131 I=26 E=8.67041e-09

probable glutamine-fructose-6-phosphate transaminase (isomerizing) protein

XFF4834R

NP_635961.1 lcl|glmS-XCC0569

228

290

S=131 I=43 E=8.67041e-09

D-fructose-6-phosphate amidotransferase

pubmed

11

341

S=605 I=43 E=1.49826e-64

NagB1 EC=3.5.99.6 ; Hydrolase

Pubmed 16457898,18671744

 

prodomImg

pubmed

11

341

S=601 I=43 E=4.41686e-64

NagB2 EC=3.5.99.6 ; Hydrolase

Pubmed 16457898,18671744

 

prodomImg

pubmed

1

337

S=209 I=27 E=1.50353e-16

Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] EC=2.6.1.16 ; Cytoplasm Glutamine amidotransferase Repeat

Pubmed 8376346

 

prodomImg

pubmed

1

337

S=208 I=27 E=1.55689e-16

Putative glucosamine-fructose-6-phosphate aminotransferase

Pubmed 20142038

 

prodomImg

pubmed

48

337

S=202 I=26 E=8.59829e-16

Glucosamine 6-phosphate synthetase Glucosamine--fructose-6-phosphate aminotransferase, isomerizing EC=2.6.1.16

Pubmed 16861657

 

prodomImg

sp_Pdown

sp|O26273|GLMS_METTH

31

337

S=242 I=29 E=9.40611e-21

Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] EC=2.6.1.16 ; Cytoplasm Glutamine amidotransferase Repeat

sp_Pdown

sp|Q8U4D1|GLMS_PYRFU

8

337

S=235 I=25 E=7.17242e-20

Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] EC=2.6.1.16 ; Cytoplasm Glutamine amidotransferase Repeat

sp_Pdown

sp|Q65P46|GLMS_BACLD

6

337

S=210 I=28 E=6.16889e-17

Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] EC=2.6.1.16 ; Cytoplasm Glutamine amidotransferase Repeat

sp_Pdown

sp|P39754|GLMS_BACSU

1

337

S=209 I=27 E=1.02288e-16

Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] EC=2.6.1.16 ; Cytoplasm Glutamine amidotransferase Repeat

sp_Pdown

sp|Q4J6D9|GLMS_SULAC

48

337

S=205 I=26 E=2.78787e-16

Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] EC=2.6.1.16 ; Cytoplasm Glutamine amidotransferase Repeat

Iprscan [G3DSA:3.40.50.10490]

12

175

-

Iprscan [G3DSA:3.40.50.10490]

185

337

-

Iprscan [PTHR10937]

48

342

-

Iprscan IPR001347 [PF01380]

49

166

Sugar isomerase (SIS)

Iprscan IPR001347 [PF01380]

205

301

Sugar isomerase (SIS)

Iprscan [seg]

113

127

-

Iprscan [seg]

175

189

-

Iprscan [seg]

213

227

-

PD512982

51

101

S=197 I=78 E=2.18998e-16

PD496765

11

50

S=184 I=93 E=7.28811e-15

PDA1J5F3

312

342

S=150 I=94 E=1.04761e-10

PD002268

31

158

S=141 I=33 E=1.43268e-09

PD002268

228

337

S=138 I=31 E=3.05897e-09

PDA1W518

283

311

S=136 I=93 E=5.73065e-09

PDA28446

313

342

S=104 I=67 E=3.96022e-05

Iprscan [SSF53697]

6

337

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YubR8QMZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

151 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBWNX4Pp/XFF4834R_chr07220.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBWNX4Pp/XFF4834R_chr07220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBWNX4Pp/XFF4834R_chr07220.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBWNX4Pp/XFF4834R_chr07220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.