Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr22950galUXFF4834R_chr22950UTP--glucose-1-phosphate uridylyltransferase

galU XFF4834R_chr22950
XFF4834R_chr22940
XFF4834R_chr22940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr22960
XFF4834R_chr22960
ID galU
AC XFF4834R_chr22950
LT XFF4834R_chr22950
OR XFF4834R_chr from 2659652 to 2660545 on strand -
DE UTP--glucose-1-phosphate uridylyltransferase
IP UTP--glucose-1-phosphate uridylyltransferase, bacterial/archaeal type
CL 1.7.10 Sugar nucleotide biosynthesis, conversions GO:0009226
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Biological Process: UDP-glucose metabolic process (GO:0006011)
Molecular Function: UTP:glucose-1-phosphate uridylyltransferase activity (GO:0003983)
Molecular Function: nucleotidyltransferase activity (GO:0016779)

Curated
PM
AN synonym: uridine diphosphoglucose pyrophosphorylase XANCA pubmed 8831665. TIGR01099 : Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides (CL 1.6.3) and CL 1.6 (production of Xanthan gum)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100826)
MW 32115.5 Da
SQ 297 aa
 
........10........20........30........40........50
| | | | |
MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAG
CDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVR
AIFVTQAEALGLGHAVLCAKAVVGNEPFAVLLPDDLMWNRGDAALTQMAN
VAEASGGSVIAVEDVPHDKTASYGIVSTDAFDGRKGRINAIVEKPKPEVA
PSNLAVVGRYVLSPKIFDLLEATGAGVGGEIQLTDAIAELLKEEQVDAFR
FEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILREALAQADARG
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr34780 lcl|rfbA-XFF4834R_chr34780

6

268

S=141 I=26 E=1.35598e-10

glucose-1-phosphate thymidylyltransferase

XFF4834R

XFF4834R_chr34780 lcl|rfbA-XFF4834R_chr34780

6

268

S=141 I=26 E=1.35598e-10

glucose-1-phosphate thymidylyltransferase

XFF4834R

NP_642609.1 lcl|galU-XAC2292

1

297

S=1538 I=99 E=2.693e-179

UTP-glucose-1-phosphate uridylyltransferase

XFF4834R

YP_364221.1 lcl|galU-XCV2490

1

297

S=1536 I=99 E=4.35005e-179

UTP-glucose-1-phosphate uridylyltransferase

XFF4834R

NP_637544.1 lcl|galU-XCC2188

1

297

S=1497 I=96 E=2.56738e-174

UTP-glucose-1-phosphate uridylyltransferase

XFF4834R

lcl|galU-XALc_1596

1

292

S=1232 I=82 E=2.82421e-142

probable utp-glucose-1-phosphate uridylyltransferase protein

XFF4834R

NP_636014.1 lcl|rmlA-XCC0622

1

235

S=155 I=28 E=9.61798e-12

glucose-1-phosphate thymidylyltransferase

XFF4834R

NP_643891.1 lcl|rmlA-XAC3584

1

235

S=149 I=28 E=4.7841e-11

glucose-1-phosphate thymidylyltransferase

XFF4834R

YP_365439.1 lcl|rmlA-XCV3708

1

235

S=147 I=27 E=9.44383e-11

glucose-1-phosphate thymidylyltransferase

XFF4834R

lcl|rmlA-XALc_2696

1

268

S=133 I=25 E=3.80738e-09

probable glucose-1-phosphate thymidylyltransferase protein

pubmed

1

296

S=1493 I=96 E=2.56519e-172

UDP-glucose pyrophosphorylase

Pubmed 8831665

 

prodomImg

pubmed

1

291

S=808 I=55 E=2.89948e-89

UDP-glucose pyrophosphorylase EpsT

Pubmed 12624205

 

prodomImg

pubmed

5

279

S=772 I=56 E=6.27869e-85

UDP-glucose pyrophosphorylase EC=2.7.7.9 ; Nucleotidyltransferase

Pubmed 15932984

 

prodomImg

pubmed

5

275

S=707 I=51 E=4.28694e-77

UDP glucose pyrophosphorylase

Pubmed 12655408

 

prodomImg

pubmed

5

275

S=707 I=51 E=4.28694e-77

Glucose-1-phosphate uridylyltransferase ; Nucleotidyltransferase

Pubmed 12655408,16085866

 

prodomImg

pubmed

5

292

S=699 I=51 E=4.13656e-76

GalU

Pubmed 17660404

 

prodomImg

pubmed

7

288

S=685 I=49 E=2.03801e-74

UTP-glucose-1-phosphate uridylyltransferase ; Nucleotidyltransferase

Pubmed 10696481

 

prodomImg

pubmed

3

274

S=676 I=49 E=2.66824e-73

UTP--glucose-1-phosphate uridylyltransferase EC=2.7.7.9 ; Carbohydrate metabolism Nucleotidyltransferase

Pubmed 17209021

 

prodomImg

pubmed

3

274

S=664 I=48 E=8.06769e-72

UTP--glucose-1-phosphate uridylyltransferase EC=2.7.7.9 ; Carbohydrate metabolism Nucleotidyltransferase Stress response

Pubmed 8320212,8126437

 

prodomImg

pubmed

2

288

S=658 I=48 E=4.19178e-71

UDP-glucose pyrophosphorylase

Pubmed 11425718

 

prodomImg

sp_Pdown

sp|Q8CR67|GTAB_STAES

3

274

S=690 I=49 E=3.93246e-75

UTP--glucose-1-phosphate uridylyltransferase EC=2.7.7.9 ; Carbohydrate metabolism Nucleotidyltransferase

sp_Pdown

sp|Q5HLD1|GTAB_STAEQ

3

274

S=690 I=49 E=3.93246e-75

UTP--glucose-1-phosphate uridylyltransferase EC=2.7.7.9 ; Carbohydrate metabolism Nucleotidyltransferase

sp_Pdown

sp|Q9F664|GALU_HAEDU

7

288

S=687 I=51 E=9.24148e-75

UTP--glucose-1-phosphate uridylyltransferase EC=2.7.7.9 ; Nucleotidyltransferase

sp_Pdown

sp|Q49VP4|GTAB2_STAS1

3

276

S=683 I=50 E=2.60817e-74

UTP--glucose-1-phosphate uridylyltransferase 2 EC=2.7.7.9 ; Carbohydrate metabolism Nucleotidyltransferase

sp_Pdown

sp|Q9I291|GALU_PSEAE

5

282

S=682 I=48 E=3.10503e-74

UTP--glucose-1-phosphate uridylyltransferase EC=2.7.7.9 ; Nucleotidyltransferase

Iprscan [G3DSA:3.90.550.10]

4

279

-

Iprscan [PTHR22572:SF14]

14

286

-

Iprscan [PTHR22572]

14

286

-

Iprscan IPR005835 [PF00483]

12

268

Nucleotidyl transferase

Iprscan IPR005771 [TIGR01099]

5

267

UTP--glucose-1-phosphate uridylyltransferase, bacterial/archaeal type

PD001252

13

280

S=345 I=37 E=2.46677e-34

PDA1Q9K8

242

297

S=281 I=95 E=1.72889e-26

PDA1Q7O1

51

96

S=246 I=100 E=2.98446e-22

PDA0Y5L1

176

260

S=230 I=58 E=2.48099e-20

PDA036R5

103

274

S=155 I=27 E=3.00919e-11

PDA1T9F4

51

72

S=120 I=86 E=5.52147e-07

PDA86754

54

121

S=111 I=43 E=6.01945e-06

PD787780

186

268

S=110 I=33 E=7.16617e-06

PDA3U140

226

254

S=107 I=72 E=1.97025e-05

PDA275W4

237

279

S=103 I=49 E=6.50538e-05

Iprscan [SSF53448]

6

275

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xeT47Tbh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

235 hits
swiss-prot

Swiss-Prot ncbi-blastp

73 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpra2IB/XFF4834R_chr22950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpra2IB/XFF4834R_chr22950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpra2IB/XFF4834R_chr22950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpra2IB/XFF4834R_chr22950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.