Xanthomonas fuscans subsp. fuscans

6 hits

  1. XFF4834R_chr00960glgB1XFF4834R_chr00960putative 1,4-alpha-glucan branching enzyme
  2. XFF4834R_chr04130XFF4834R_chr04230635_0466743_r1_XFF4834R-XFF4834R_chr04130XFF4834R_chr04130Putative phosphoglycerol transferase I
  3. XFF4834R_chr04170glgAXFF4834R_chr04170probable glycogen synthase
  4. XFF4834R_chr04180glgB2XFF4834R_chr04180probable glycogen branching enzyme
  5. XFF4834R_chr34840XFF4834R_chr37980501_4039917_f1_XFF4834R-XFF4834R_chr34840XFF4834R_chr34840putative membrane protein involved in synthesis of cell surface polysaccharides
  6. XFF4834R_chr35420XFF4834R_chr38650522_4115875_f2_XFF4834R-XFF4834R_chr35420XFF4834R_chr35420Putative GtrA family protein

glgB1 XFF4834R_chr00960
XFF4834R_chr00950
XFF4834R_chr00950
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00970
XFF4834R_chr00970
ID glgB1
AC XFF4834R_chr00960
LT XFF4834R_chr00960
OR XFF4834R_chr from 113258 to 115456 on strand -
DE putative 1,4-alpha-glucan branching enzyme
IP 1,4-alpha-glucan branching enzyme, core region; Trehalose synthase/alpha-amylase, N-terminal
CL 1.6.9 Polysaccharides, cytoplasmic GO:0000271
EC
GO InterPro
4-alpha-glucan branching enzyme activity (GO:0003844)
Biological Process: glycogen biosynthetic process (GO:0005978)
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110103)
MW 80875.4 Da
SQ 732 aa
 
........10........20........30........40........50
| | | | |
MMSGVMTAVSNRWDPGVVRALAEARHGDAFAILGAHPSDNGRLLRTYLPG
ADRVSAVLDDGQVVALDAGPEPGLFAGELPVQGGYRLRIGWPGGEQETAD
PYAFGPQLSDFDLHLISEGHHLQLADALGANVVEVEGVRGTRFAVWAPNA
SRVAVVGDFNSWDARRHPMRLRHQSGVWELFVPDVGPGAHYKYQLRGPHG
HELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMATRARRQAHDAP
MSIYEIHAGSWLREAGVDLDWDGLADRLIPYVADMGFTHVELMPVSEHPF
GGSWGYQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTD
AHGLAHFDGTALYEHADPREGFHRDWNTLIYNHGRREVSGFLIASAMEFL
QRYHVDGLRVDAVASMLYRDYSRNAGEWIPNIHGGRENYETIAFLRRLNE
VVREHTPGAVMIAEESTAFPGVTADVAHGGLGFHYKWNMGWMHDTLHYAG
LDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSLLGRMPGDDW
QRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDPRH
RGVQTLVRDLNRLYVQYPALHVHDDDPSGFAWVVGDDAGNSVVAFLRKGK
RGDAPVLVVINFTPVVQHGYRIGVPQGGQWREVFNSDAGIYGGANLGNGG
SVTAEPQSMHGHAQSLPLVLPPLGAIVLTPYG
XFF4834R

XFF4834R_chr04180 lcl|glgB-XFF4834R_chr04180

17

728

S=2092 I=59 E=0

1,4-alpha-glucan branching enzyme

XFF4834R

XFF4834R_chr04190 lcl|XFF4834R_chr04330084_0477841_f2_XFF4834R-XFF4834R_chr04190

141

416

S=210 I=30 E=1.37093e-18

XFF4834R

XFF4834R_chr04230 lcl|XFF4834R_chr04370721_0484883_f3_XFF4834R-XFF4834R_chr04230

275

420

S=135 I=30 E=1.96238e-09

XFF4834R

XFF4834R_chr13830 lcl|glgX-XFF4834R_chr13830

217

422

S=129 I=29 E=9.5924e-09

glycogen debranching enzyme

XFF4834R

YP_361872.1 lcl|glgB1-XCV0141

1

732

S=3663 I=97 E=0

glycogen branching enzyme

XFF4834R

NP_640512.2 lcl|glgB1-XAC0156

6

732

S=3628 I=97 E=0

glycogen branching enzyme

XFF4834R

NP_635530.2 lcl|glgB1-XCC0135

6

732

S=3468 I=92 E=0

glycogen branching enzyme

XFF4834R

lcl|glgB-XALc_2649

6

728

S=2905 I=76 E=0

probable 1,4-alpha-glucan branching enzyme protein

XFF4834R

NP_635803.1 lcl|glgB2-XCC0409

18

728

S=2130 I=59 E=0

glycogen branching enzyme

XFF4834R

NP_640781.2 lcl|glgB2-XAC0426

17

728

S=2072 I=58 E=0

glycogen branching enzyme

XFF4834R

YP_362183.1 lcl|glgB2-XCV0452

17

728

S=2053 I=58 E=0

glycogen branching enzyme

XFF4834R

YP_362184.1 lcl|XCV0453

141

416

S=213 I=30 E=2.31571e-18

alpha-amylase family protein

XFF4834R

NP_640782.1 lcl|XAC0427-XAC0427

141

416

S=211 I=30 E=3.97601e-18

maltooligosyltrehalose trehalohydrolase

XFF4834R

NP_635804.1 lcl|XCC0410

141

416

S=207 I=30 E=1.21372e-17

maltooligosyltrehalose trehalohydrolase

XFF4834R

lcl|glgB-XALc_2592

143

416

S=175 I=29 E=8.83802e-14

putative 1,4-alpha-glucan branching enzyme protein

XFF4834R

NP_640786.1 lcl|glgX-XAC0431

275

420

S=135 I=30 E=6.95514e-09

glycogen debranching enzyme

XFF4834R

YP_362188.1 lcl|glgX1-XCV0457

275

420

S=135 I=30 E=7.13946e-09

glycogen debranching enzyme

XFF4834R

NP_635808.1 lcl|glgX-XCC0414

275

420

S=131 I=30 E=2.27652e-08

glycogen debranching enzyme

XFF4834R

YP_365099.1 lcl|glgX2-XCV3368

217

422

S=130 I=29 E=3.19849e-08

glycogen debranching enzyme

XFF4834R

NP_643562.1 lcl|glgX-XAC3254

217

422

S=129 I=29 E=3.61373e-08

glycogen debranching enzyme

XFF4834R

lcl|glgX-XALc_2596

140

421

S=123 I=26 E=1.87761e-07

probable glycogen debranching enzyme protein

XFF4834R

NP_638456.1 lcl|glgX-XCC3109

253

422

S=121 I=29 E=3.39694e-07

glycogen debranching enzyme

pubmed

9

729

S=1927 I=53 E=0

1,4-alpha-glucan-branching enzyme EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Pubmed 3013861

 

prodomImg

pubmed

5

729

S=1867 I=53 E=0

Glycogen branching enzyme

Pubmed 18594899

 

prodomImg

pubmed

5

729

S=1867 I=53 E=0

1,4-alpha-glucan-branching enzyme EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Pubmed 12480526

 

prodomImg

pubmed

18

730

S=1845 I=51 E=0

1,4-alpha-glucan-branching enzyme EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Pubmed 9851999

 

prodomImg

pubmed

21

730

S=1826 I=53 E=0

1,4-alpha-glucan-branching enzyme EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Pubmed 8068720

 

prodomImg

sp_Pdown

sp|Q3BZE1|GLGB1_XANC5

1

732

S=3663 I=97 E=0

1,4-alpha-glucan-branching enzyme 1 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

sp_Pdown

sp|Q8PR13|GLGB1_XANAC

9

732

S=3611 I=97 E=0

1,4-alpha-glucan-branching enzyme 1 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

sp_Pdown

sp|Q2P949|GLGB2_XANOM

2

732

S=3580 I=94 E=0

1,4-alpha-glucan-branching enzyme 2 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

sp_Pdown

sp|Q5H6H2|GLGB1_XANOR

1

732

S=3577 I=94 E=0

1,4-alpha-glucan-branching enzyme 1 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

sp_Pdown

sp|Q8PE48|GLGB1_XANCP

9

732

S=3446 I=91 E=0

1,4-alpha-glucan-branching enzyme 1 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Iprscan IPR013783 [G3DSA:2.60.40.10]

115

227

Immunoglobulin-like fold

Iprscan IPR013781 [G3DSA:3.20.20.80]

232

616

Glycoside hydrolase, subgroup, catalytic core

Iprscan IPR013780 [G3DSA:2.60.40.1180]

627

729

Glycosyl hydrolase, family 13, all-beta

Iprscan IPR006407 [MF_00685]

104

731

1,4-alpha-glucan branching enzyme, core region

Iprscan [PTHR10357:SF13]

208

728

-

Iprscan [PTHR10357]

208

728

-

Iprscan IPR004193 [PF02922]

128

211

Glycoside hydrolase, family 13, N-terminal

Iprscan IPR006048 [PF02806]

632

729

Alpha-amylase, C-terminal all beta

Iprscan IPR006047 [PF00128]

270

350

Glycosyl hydrolase, family 13, catalytic domain

Iprscan IPR006589 [SM00642]

255

608

Glycosyl hydrolase, family 13, subfamily, catalytic domain

Iprscan IPR006407 [TIGR01515]

112

729

1,4-alpha-glucan branching enzyme, core region

Iprscan [seg]

688

700

-

PD606980

509

729

S=657 I=58 E=5.67297e-72

PD567709

354

493

S=306 I=48 E=2.04334e-29

PDA033Z2

428

498

S=266 I=70 E=1.66509e-24

PD376916

163

244

S=199 I=49 E=1.952e-16

PD880365

44

131

S=182 I=49 E=1.98302e-14

PD896127

9

43

S=173 I=94 E=2.8826e-13

PD002139

251

305

S=132 I=46 E=2.43236e-08

PDA0V2G2

669

730

S=125 I=46 E=1.88737e-07

PDA8K1I9

141

292

S=124 I=29 E=2.13239e-07

PD007429

132

162

S=122 I=74 E=4.75582e-07

Iprscan IPR017853 [SSF51445]

169

620

Glycoside hydrolase, catalytic core

Iprscan [SSF51011]

627

730

-

Iprscan IPR014756 [SSF81296]

25

116

Immunoglobulin E-set

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one mtHCmQtH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

146 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr00960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr00960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr00960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr00960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr04230635_0466743_r1_XFF4834R-XFF4834R_chr04130 XFF4834R_chr04130
XFF4834R_chr04130
XFF4834R_chr04130
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0453
XFF4834R_chr_0453
ID XFF4834R_chr04230635_0466743_r1_XFF4834R-XFF4834R_chr04130
AC XFF4834R_chr04130
LT XFF4834R_chr04130
OR XFF4834R_chr from 464635 to 466743 on strand -
DE Putative phosphoglycerol transferase I
IP Phosphoglycerol transferase I
CL 1.6.9 Polysaccharides, cytoplasmic GO:0000271
EC
GO InterPro
Biological Process: glucan biosynthetic process (GO:0009250)
Biological Process: metabolic process (GO:0008152)
Cellular Component: plasma membrane (GO:0005886)
Molecular Function: phosphatidylglycerol-membrane-oligosaccharide glycerophosphotransferase activity (GO:0008960)
Molecular Function: sulfuric ester hydrolase activity (GO:0008484)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100819)
MW 77707.4 Da
SQ 702 aa
 
........10........20........30........40........50
| | | | |
MHWMLLVSLLLLLWLLVASPRLAWLKAGLLSLFLLLLSAWGLVDRLSGDG
INAATLYHLRADMDGAGVSDFSGYIAVFVGMLLLSLSPLLLVRVRRFQHP
RGGGAVFAGFVGMLLVGIAASPLYRDGKRLYYQLRPVDYATVVPEYQVPQ
QPLQKRKNIVWIYGESLERTYFDEQVFPGLMPNLRALATEAVDVRNLAST
EGSGWTIAGMVASMCGVPLTTAPGDENSMDRMGMFLPEARCLGDYLKDQG
YRNHYVGGADASFAGKGRFLSSHGFDVVHDVHHFHDKGVAQKHFSAWGVH
DDVLLDDAWDSFQTLSRAGQPFMLTTLTMDTHHPAGHLPLACKGQHYDSA
LGDIGLLHAIKCSDRLIGELVARIRNSRYGKNTIIVIASDHLAMPNDLSD
VLAKQKRENLLLFLGKDIAPQQVVTRAGSTLDSGATLLQLLEPGMRTLGF
GRSLLASDAPPSASVAASRDSGKDYPRYLAYARTLWTGRSTRMLRINGNG
DVVVGVQQVRPPVLLEYDKDTNLKTVYLENTSRQFDRTHSKGTLAYVDRC
TAFEDGSADGDWCALVVDRHQSMKLYRDPDLTRGIAVDAPLEATQQGPRP
RVRQPIMLTQEARKTDAGRYMLELYAKRRPTRAFWVEAVSSERKVVLAQQ
WVVPDAAGRIRMPVGLEHAVEDLEIRAWLDYTEDVSVDDLALVKDIPVAD
RS
XFF4834R

YP_362177.1 lcl|mdoB-XCV0446

1

702

S=3038 I=85 E=0

phosphoglycerol transferase I

XFF4834R

NP_640776.2 lcl|mdoB-XAC0421

1

702

S=3017 I=84 E=0

phosphoglycerol transferase I

XFF4834R

NP_635797.2 lcl|mdoB-XCC0403

1

702

S=2836 I=80 E=0

phosphoglycerol transferase I

sp_Pdown

sp|Q3BYI6|OPGB_XANC5

1

702

S=3038 I=85 E=0

Phosphoglycerol transferase I EC=2.7.8.20 ; Cell inner membrane Transmembrane

sp_Pdown

sp|Q8PQA7|OPGB_XANAC

1

702

S=3017 I=84 E=0

Phosphoglycerol transferase I EC=2.7.8.20 ; Cell inner membrane Transmembrane

sp_Pdown

sp|Q8PDD7|OPGB_XANCP

1

702

S=2836 I=80 E=0

Phosphoglycerol transferase I EC=2.7.8.20 ; Cell inner membrane Transmembrane

sp_Pdown

sp|B0RMT0|OPGB_XANCB

1

702

S=2832 I=80 E=0

Phosphoglycerol transferase I EC=2.7.8.20 ; Cell inner membrane Transmembrane

sp_Pdown

sp|B7UQY8|OPGB_ECO27

44

451

S=654 I=39 E=2.64811e-70

Phosphoglycerol transferase I EC=2.7.8.20 ; Cell inner membrane Transmembrane

Iprscan IPR017849 [G3DSA:3.40.720.10]

155

455

Alkaline phosphatase-like, alpha/beta/alpha

Iprscan IPR020881 [MF_01070]

1

702

Phosphoglycerol transferase I

Iprscan [PTHR10342]

233

391

-

Iprscan IPR000917 [PF00884]

157

459

Sulfatase

Iprscan [seg]

5

17

-

Iprscan [seg]

22

42

-

Iprscan [seg]

82

91

-

Iprscan [seg]

102

112

-

Iprscan [seg]

275

286

-

Iprscan [seg]

452

471

-

Iprscan [seg]

502

513

-

Iprscan [SignalP-NN(euk)]

1

41

-

Iprscan [tmhmm]

5

24

-

Iprscan [tmhmm]

73

95

-

Iprscan [tmhmm]

102

124

-

PD717243

472

702

S=1086 I=92 E=6.44041e-124

PD605628

43

240

S=296 I=42 E=3.11814e-28

PD698194

360

451

S=264 I=55 E=2.27055e-24

PDA1Y2S4

335

380

S=216 I=87 E=1.41086e-18

Iprscan IPR017850 [SSF53649]

155

456

Alkaline-phosphatase-like, core domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xrVmN7yA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

38 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04130.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04130.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
glgA XFF4834R_chr04170
XFF4834R_chr_0457
XFF4834R_chr_0457
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04180
XFF4834R_chr04180
ID glgA
AC XFF4834R_chr04170
LT XFF4834R_chr04170
OR XFF4834R_chr from 472270 to 473853 on strand +
DE probable glycogen synthase
IP Glycogen/starch synthases, ADP-glucose type
CL 1.6.9 Polysaccharides, cytoplasmic GO:0000271
EC
GO InterPro
Biological Process: glucan biosynthetic process (GO:0009250)
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: starch synthase activity (GO:0009011)

Curated
PM
AN glycogen metabolism
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 56839.9 Da
SQ 527 aa
 
........10........20........30........40........50
| | | | |
MVAMMPLHATTARLERSTLLPTLKKSGRPRDARGRFIRHHERLPVSLADT
RGALFVVSEMADFIKAGGLGDVAAALPRALRHRYDVRVLIPGYRAVLERA
GKVEIVGRVLAHAALPACDIGRIVQSDGLPIYILLSKELFERDGSPYVST
SGSEFEDNAIRFATLSHAAAQIAAGHAGLGWKPRLLHLNDWPCALAAGYV
RWSGGTTPCLLTIHNLAYQGLVPYSMAAALGIPAERVAELEFYGQMSFLR
GGIVNADHVNTVSVSYAKQITGPAQGCGLDRLLAGRAAKGALTGIVNGID
ASWDPRTDQYLDSHFSVNQWQGRQANAAQVRKAFGLRESTGPLFAVVSRL
VHQKGLDLICEVAPQIVAAGGQIAVIGGGEPEIEQQVAELTRRYPGQVGA
FIGFEEGLARRMFAGADFLLMPSRFEPCGLSQMYAQRFGCLPIAHATGGL
IDTVDDGVTGFLFQHASVEALRRCLERAFRTFRLPSLLSAMRRAAMLRPS
GWDVAGKKYLSLYEHTAATAPALATVP
XFF4834R

YP_362182.1 lcl|glgA-XCV0451

1

515

S=2431 I=91 E=0

glycogen synthase

XFF4834R

NP_640780.1 lcl|glgA-XAC0425

54

527

S=2163 I=88 E=0

glycogen synthase

XFF4834R

NP_635802.1 lcl|glgA-XCC0408

54

514

S=2106 I=88 E=0

glycogen synthase

XFF4834R

lcl|glgA-XALc_2591

42

514

S=1639 I=69 E=0

probable glycogen synthase protein

pubmed

126

513

S=951 I=49 E=2.73522e-106

Putative glycogen synthase

Pubmed 17351032

 

prodomImg

pubmed

54

513

S=715 I=35 E=1.17637e-77

Glycogen synthase 2 EC=2.4.1.21 ; biosynthesis Glycosyltransferase Plasmid

Pubmed 11481431

 

prodomImg

pubmed

54

513

S=712 I=36 E=2.83779e-77

Glycogen synthase EC=2.4.1.21 ; biosynthesis Glycosyltransferase

Pubmed 3040691

 

prodomImg

pubmed

54

513

S=709 I=36 E=5.40981e-77

Glycogen synthase EC=2.4.1.21 ; biosynthesis Glycosyltransferase

Pubmed 3097003

 

prodomImg

pubmed

35

514

S=685 I=34 E=4.94571e-74

Glycogen synthase GlgA

Pubmed 17240088

 

prodomImg

sp_Pdown

sp|Q3BYI1|GLGA_XANC5

19

515

S=2338 I=90 E=0

Glycogen synthase EC=2.4.1.21 ; biosynthesis Glycosyltransferase

sp_Pdown

sp|Q5H6Q4|GLGA_XANOR

19

514

S=2283 I=88 E=0

Glycogen synthase EC=2.4.1.21 ; biosynthesis Glycosyltransferase

sp_Pdown

sp|Q2P9F6|GLGA_XANOM

19

514

S=2283 I=88 E=0

Glycogen synthase EC=2.4.1.21 ; biosynthesis Glycosyltransferase

sp_Pdown

sp|B2SVT3|GLGA_XANOP

19

514

S=2281 I=88 E=0

Glycogen synthase EC=2.4.1.21 ; biosynthesis Glycosyltransferase

sp_Pdown

sp|Q8PQA3|GLGA_XANAC

54

527

S=2163 I=88 E=0

Glycogen synthase EC=2.4.1.21 ; biosynthesis Glycosyltransferase

Iprscan IPR011835 [MF_00484]

51

516

Glycogen/starch synthases, ADP-glucose type

Iprscan [PTHR12526:SF17]

63

514

-

Iprscan [PTHR12526]

63

514

-

Iprscan IPR013534 [PF08323]

54

284

Starch synthase, catalytic domain

Iprscan IPR001296 [PF00534]

337

477

Glycosyl transferase, group 1

Iprscan IPR011835 [TIGR02095]

54

516

Glycogen/starch synthases, ADP-glucose type

Iprscan [seg]

167

178

-

Iprscan [seg]

276

292

-

Iprscan [seg]

365

379

-

Iprscan [seg]

516

525

-

PD187428

59

467

S=590 I=37 E=7.78148e-64

PDA2X621

1

58

S=282 I=95 E=1.50237e-26

PDA7K2D5

54

123

S=168 I=51 E=1.06614e-12

PD692870

492

515

S=128 I=100 E=7.36149e-08

Iprscan [SSF53756]

53

516

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1N676Tv2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

675 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
glgB2 XFF4834R_chr04180
XFF4834R_chr04170
XFF4834R_chr04170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04190
XFF4834R_chr04190
ID glgB2
AC XFF4834R_chr04180
LT XFF4834R_chr04180
OR XFF4834R_chr from 473850 to 476081 on strand +
DE probable glycogen branching enzyme
IP 1,4-alpha-glucan branching enzyme, core region; Trehalose synthase/alpha-amylase, N-terminal
CL 1.6.9 Polysaccharides, cytoplasmic GO:0000271
EC
GO InterPro
4-alpha-glucan branching enzyme activity (GO:0003844)
Biological Process: carbohydrate metabolic process (GO:0005975)
Biological Process: glycogen biosynthetic process (GO:0005978)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN 1,4-alpha-glucan branching enzyme; GH13; glycogen metabolism
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110103)
MW 81848.4 Da
SQ 743 aa
 
........10........20........30........40........50
| | | | |
MSERQGGQEQRAQADGMTTEGISEMSQTLQALADGLPADAFAVLGPKPLA
DGRRQVRVLAPGAEAMGLIDPRGKLLARMQASAIDGVFEGTLAVDGPYRL
RIVWPDRVQEVEDPYAFAATLDESLLLQIAAGDGQALRRALGAQHVHCGD
VPGVRFALWAPHAQRVAVVGDFNSWDVRRHPMRQRIGGFWELFLPRVDAG
ARYKYAVTAADGRVLLKADPVARQTELPPATASVVPSAATFAWTDAAWMA
SRDPGAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTH
IELLPITEHPFGGSWGYQPLGLYAPTARHGSPDGFAQFVDACHRAGIGVI
LDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVT
AYLLGSALEWIEHYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENL
EAVAFLRQLNRDIATQFPGVLTIAEESTAWPGVTAAINEGGLGFTHKWNM
GWMHDTLGYMQRDPAERAHHHSQLTFGLVYAFDERFVLPLSHDEVVHGTG
GLLGQMPGDDWRRFANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQS
LDWHLLDGARHRGMQQLVGDLNAALRRTPALYRGTHRAEGFDWSVADDAR
NSVLAFVRHDPDGGAPLLAVSNLTPQPHHDYHVGVPRAGLWREILNTDSA
HYGGSNLGNSGRLATEPVGMHGHAQRLRLTLPPLATIYLQAEK
XFF4834R

XFF4834R_chr00960 lcl|glgB-XFF4834R_chr00960

28

739

S=2113 I=59 E=0

1,4-alpha-glucan branching enzyme

XFF4834R

XFF4834R_chr04190 lcl|XFF4834R_chr04330084_0477841_f2_XFF4834R-XFF4834R_chr04190

154

427

S=240 I=31 E=3.81175e-22

XFF4834R

XFF4834R_chr04230 lcl|XFF4834R_chr04370721_0484883_f3_XFF4834R-XFF4834R_chr04230

286

433

S=151 I=31 E=2.219e-11

XFF4834R

XFF4834R_chr13830 lcl|glgX-XFF4834R_chr13830

263

431

S=144 I=28 E=1.73689e-10

glycogen debranching enzyme

XFF4834R

NP_640781.2 lcl|glgB2-XAC0426

17

743

S=3688 I=97 E=0

glycogen branching enzyme

XFF4834R

YP_362183.1 lcl|glgB2-XCV0452

1

743

S=3685 I=96 E=0

glycogen branching enzyme

XFF4834R

NP_635803.1 lcl|glgB2-XCC0409

27

743

S=3232 I=86 E=0

glycogen branching enzyme

XFF4834R

lcl|glgB-XALc_2649

28

739

S=2063 I=58 E=0

probable 1,4-alpha-glucan branching enzyme protein

XFF4834R

NP_635530.2 lcl|glgB1-XCC0135

30

725

S=2046 I=60 E=0

glycogen branching enzyme

XFF4834R

NP_640512.2 lcl|glgB1-XAC0156

26

725

S=2025 I=59 E=0

glycogen branching enzyme

XFF4834R

YP_361872.1 lcl|glgB1-XCV0141

29

725

S=2015 I=59 E=0

glycogen branching enzyme

XFF4834R

YP_362184.1 lcl|XCV0453

154

427

S=256 I=32 E=1.8047e-23

alpha-amylase family protein

XFF4834R

NP_635804.1 lcl|XCC0410

154

427

S=241 I=32 E=1.12514e-21

maltooligosyltrehalose trehalohydrolase

XFF4834R

NP_640782.1 lcl|XAC0427-XAC0427

154

427

S=238 I=31 E=2.69065e-21

maltooligosyltrehalose trehalohydrolase

XFF4834R

lcl|glgB-XALc_2592

154

427

S=216 I=31 E=1.01969e-18

putative 1,4-alpha-glucan branching enzyme protein

XFF4834R

YP_362188.1 lcl|glgX1-XCV0457

286

433

S=151 I=31 E=8.50817e-11

glycogen debranching enzyme

XFF4834R

NP_640786.1 lcl|glgX-XAC0431

286

433

S=151 I=31 E=8.81013e-11

glycogen debranching enzyme

XFF4834R

NP_635808.1 lcl|glgX-XCC0414

286

433

S=146 I=31 E=2.9344e-10

glycogen debranching enzyme

XFF4834R

NP_643562.1 lcl|glgX-XAC3254

288

431

S=143 I=29 E=8.42727e-10

glycogen debranching enzyme

XFF4834R

YP_365099.1 lcl|glgX2-XCV3368

288

431

S=143 I=29 E=8.50107e-10

glycogen debranching enzyme

XFF4834R

NP_638456.1 lcl|glgX-XCC3109

288

431

S=128 I=27 E=5.53617e-08

glycogen debranching enzyme

XFF4834R

lcl|glgX-XALc_2596

286

432

S=127 I=27 E=7.06694e-08

probable glycogen debranching enzyme protein

pubmed

17

742

S=1835 I=52 E=0

Glycogen branching enzyme

Pubmed 18594899

 

prodomImg

pubmed

17

742

S=1835 I=52 E=0

1,4-alpha-glucan-branching enzyme EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Pubmed 12480526

 

prodomImg

pubmed

28

742

S=1822 I=51 E=0

1,4-alpha-glucan-branching enzyme EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Pubmed 3013861

 

prodomImg

pubmed

27

739

S=1728 I=50 E=0

1,4-alpha-glucan-branching enzyme EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Pubmed 10407163

 

prodomImg

pubmed

29

743

S=1722 I=50 E=0

1,4-alpha-glucan-branching enzyme EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Pubmed 9851999

 

prodomImg

sp_Pdown

sp|Q3BYI0|GLGB2_XANC5

1

743

S=3685 I=96 E=0

1,4-alpha-glucan-branching enzyme 2 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

sp_Pdown

sp|Q8PQA2|GLGB2_XANAC

25

743

S=3645 I=97 E=0

1,4-alpha-glucan-branching enzyme 2 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

sp_Pdown

sp|Q2P9F7|GLGB1_XANOM

1

743

S=3599 I=92 E=0

1,4-alpha-glucan-branching enzyme 1 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

sp_Pdown

sp|Q5H6Q3|GLGB2_XANOR

25

743

S=3493 I=93 E=0

1,4-alpha-glucan-branching enzyme 2 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

sp_Pdown

sp|Q8PDD1|GLGB2_XANCP

27

743

S=3232 I=86 E=0

1,4-alpha-glucan-branching enzyme 2 EC=2.4.1.18 ; Glycogen biosynthesis Glycosyltransferase

Iprscan IPR013783 [G3DSA:2.60.40.10]

128

238

Immunoglobulin-like fold

Iprscan IPR013781 [G3DSA:3.20.20.80]

248

627

Glycoside hydrolase, subgroup, catalytic core

Iprscan IPR013780 [G3DSA:2.60.40.1180]

638

742

Glycosyl hydrolase, family 13, all-beta

Iprscan IPR006407 [MF_00685]

117

742

1,4-alpha-glucan branching enzyme, core region

Iprscan [PTHR10357:SF13]

219

739

-

Iprscan [PTHR10357]

219

739

-

Iprscan IPR004193 [PF02922]

143

222

Glycoside hydrolase, family 13, N-terminal

Iprscan IPR006048 [PF02806]

643

740

Alpha-amylase, C-terminal all beta

Iprscan IPR006047 [PF00128]

290

363

Glycosyl hydrolase, family 13, catalytic domain

Iprscan IPR006589 [SM00642]

265

610

Glycosyl hydrolase, family 13, subfamily, catalytic domain

Iprscan IPR006407 [TIGR01515]

132

740

1,4-alpha-glucan branching enzyme, core region

Iprscan [seg]

228

240

-

PD606980

514

737

S=629 I=54 E=1.46278e-68

PD567709

365

504

S=317 I=51 E=1.02635e-30

PDA033Z2

439

511

S=289 I=71 E=2.49133e-27

PD896125

25

55

S=153 I=100 E=7.3104e-11

PDA0V2G2

681

740

S=141 I=66 E=2.13461e-09

PD002139

261

316

S=138 I=52 E=4.80246e-09

PD880365

56

144

S=136 I=42 E=7.6234e-09

PD376916

176

252

S=136 I=42 E=8.99688e-09

PDA821R6

124

150

S=131 I=96 E=3.32711e-08

PDA219U5

512

540

S=129 I=86 E=6.4542e-08

Iprscan IPR017853 [SSF51445]

240

637

Glycoside hydrolase, catalytic core

Iprscan [SSF51011]

638

743

-

Iprscan IPR014756 [SSF81296]

140

235

Immunoglobulin E-set

Iprscan IPR014756 [SSF81296]

38

123

Immunoglobulin E-set

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one s27ikZSx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

154 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr04180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr37980501_4039917_f1_XFF4834R-XFF4834R_chr34840 XFF4834R_chr34840
XFF4834R_chr34830
XFF4834R_chr34830
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34850
XFF4834R_chr34850
ID XFF4834R_chr37980501_4039917_f1_XFF4834R-XFF4834R_chr34840
AC XFF4834R_chr34840
LT XFF4834R_chr34840
OR XFF4834R_chr from 4039501 to 4039917 on strand +
DE putative membrane protein involved in synthesis of cell surface polysaccharides
IP GtrA-like protein
CL 1.6.9 Polysaccharides, cytoplasmic GO:0000271
EC
GO InterPro
Biological Process: polysaccharide biosynthetic process (GO:0000271)
Biological Process: transport (GO:0006810)
Cellular Component: integral to membrane (GO:0016021)

Curated
PM
AN this gene is in the LPS biosynthesis cluster and has an ortholog in X. albilineans Members of this entry belong to the GtrA family and are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyses the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and Listeria monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120410)
MW 15340 Da
SQ 138 aa
 
........10........20........30........40........50
| | | | |
MSRLSVISQDPRLRQLFLYALCGGTGVLSDMAVYSLALFNGVGYQLANAA
GYAVGTLISFVLNRHFTFQTYDRTLLRLLMFFGMAFIGYLSSSALLWLLV
STLKINPILAKVATLGFVLVLQFSLNRAITFRINTEKK
Show or not Domain decomposition
 
XFF4834R

lcl|XALc_2702

1

138

S=379 I=55 E=2.10915e-39

putative membrane protein involved in synthesis of cell surface polysaccharides

Iprscan IPR007267 [PF04138]

19

131

GtrA-like protein

Iprscan [seg]

90

103

-

Iprscan [SignalP-NN(euk)]

1

28

-

Iprscan [tmhmm]

16

38

-

Iprscan [tmhmm]

43

62

-

Iprscan [tmhmm]

75

97

-

Iprscan [tmhmm]

107

129

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LrMvto4d)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr34840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr34840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr34840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr34840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr38650522_4115875_f2_XFF4834R-XFF4834R_chr35420 XFF4834R_chr35420
XFF4834R_chr35410
XFF4834R_chr35410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3766
XFF4834R_chr_3766
ID XFF4834R_chr38650522_4115875_f2_XFF4834R-XFF4834R_chr35420
AC XFF4834R_chr35420
LT XFF4834R_chr35420
OR XFF4834R_chr from 4115462 to 4115875 on strand +
DE Putative GtrA family protein
IP GtrA-like protein
CL 1.6.9 Polysaccharides, cytoplasmic GO:0000271
EC
GO InterPro
Biological Process: transport (GO:0006810)
Biological Process: polysaccharide biosynthetic process (GO:0000271)
Cellular Component: integral to membrane (GO:0016021)

Curated
PM
AN start modification Members of this entry belong to the GtrA family and are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane [1]. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyses the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b) [2]. This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and Listeria monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose [3].
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110711)
MW 15062.8 Da
SQ 137 aa
 
........10........20........30........40........50
| | | | |
MGAPFLCPARMSLFRQGSQFMIIGALQLAVDCGIFIAATAAGMPAVPANL
LGRIGGAMLGFWLNGRYTFAQQGDARLGWRRFRRFAVMWLTLTLISTWLL
STTVDLLGLRQAWLAKPLVEGGLAIVSFFLGRHVVYR
Show or not Domain decomposition
 
XFF4834R

YP_365494.1 lcl|XCV3763

1

137

S=523 I=78 E=7.08802e-57

hypothetical protein

XFF4834R

NP_643952.1 lcl|XAC3645-XAC3645

11

137

S=477 I=78 E=2.84808e-51

hypothetical protein

XFF4834R

NP_635949.1 lcl|XCC0557

1

137

S=456 I=69 E=9.14574e-49

hypothetical protein

XFF4834R

lcl|XALc_2903

21

137

S=268 I=51 E=5.31725e-26

hypothetical protein

Iprscan IPR007267 [PF04138]

19

135

GtrA-like protein

Iprscan [seg]

37

48

-

Iprscan [seg]

89

103

-

Iprscan [SignalP-NN(euk)]

1

40

-

Iprscan [tmhmm]

20

42

-

Iprscan [tmhmm]

46

65

-

Iprscan [tmhmm]

85

107

-

Iprscan [tmhmm]

117

136

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3HmOTBDf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr35420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr35420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr35420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WByfCeta/XFF4834R_chr35420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.