Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr06290opgHXFF4834R_chr06290Probable glucans biosynthesis glucosyltransferase H

opgH XFF4834R_chr06290
XFF4834R_chr06280
XFF4834R_chr06280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06300
XFF4834R_chr06300
ID opgH
AC XFF4834R_chr06290
LT XFF4834R_chr06290
OR XFF4834R_chr from 716009 to 717946 on strand +
DE Probable glucans biosynthesis glucosyltransferase H
IP Glycosyl transferase, family 2
CL 1.6.6 Osmoregulated periplasmic glucan GO:0009250
EC
GO InterPro


Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100819)
MW 70124.2 Da
SQ 645 aa
 
........10........20........30........40........50
| | | | |
MDGTVTPSPITTAMPPVSALDAGTPTLPPEAPLAMPEQNLREGHLQVRHQ
RTSPPGIGVRRFYLIGGTFATTAIAVWVMLSVLWPDGISVLEGCLLGLFV
LLFAWIAMSFASAVAGFVTVVARAGRKLGIDPEQPLPKLRSRTALLMPTY
NEDPRRLLAGLQAIYESVAETGQLEHFDFFVLSDTTREHIGRAEELVYNE
LCDRVGGHGRIFYRRRADNAARKAGNVADWVRRFGGSYPQMLILDADSVM
TGDTIVRLVAGMENNPDVGLIQTLPAVVNGQTLFARMQQFGGRVYGPIIA
FGVAWWHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPFGGHVLSHDFV
EAALMRRGGWAMHMVPYLQGSYEEGPPTLTDLLIRDRRWCQGNLQHAKVV
GAKGLHWISRMHMLIGIGHYFTAPMWGLLMLIGIGIPLAGGGIDLAGDLP
FSPARYWHGSSQGNAIWIFVCTMFVLLAPKLLGYIALLLNPRELRACGGA
FRAAVSILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGWDAQVRDDGKL
SWPALLRSYGGLTVFGLFMGAVAYAVSPALAAWMGPVIVGMALSIPVVAL
TSLRRTGMALRRAGIFCIPEELDPPKVLVRASELRRAAALEPSLI
XFF4834R

NP_640971.2 lcl|hrpM-XAC0618

1

645

S=2977 I=89 E=0

glucosyltransferase MdoH

XFF4834R

YP_362406.1 lcl|opgH-XCV0675

1

645

S=2960 I=89 E=0

glucosyltransferase MdoH

XFF4834R

NP_638861.1 lcl|hrpM-XCC3515

1

645

S=2803 I=84 E=0

glucosyltransferase MdoH

XFF4834R

lcl|opgH-XALc_2589

4

625

S=2121 I=67 E=0

probable glucosyltransferase mdoh protein

pubmed

104

626

S=962 I=40 E=1.70086e-107

Glucans biosynthesis glucosyltransferase H EC=2.4.1.- ; Cell inner membrane Glycosyltransferase Transmembrane

Pubmed 3192509

 

prodomImg

pubmed

104

626

S=921 I=40 E=1.49914e-102

Glucans biosynthesis glucosyltransferase H EC=2.4.1.- ; Cell inner membrane Glycosyltransferase Transmembrane

Pubmed 7934824

 

prodomImg

pubmed

104

626

S=884 I=39 E=4.56105e-98

Glucans biosynthesis glucosyltransferase H EC=2.4.1.- ; Cell inner membrane Glycosyltransferase Transmembrane

Pubmed 11325942

 

prodomImg

pubmed

86

624

S=815 I=37 E=9.50641e-90

Glucans biosynthesis glucosyltransferase H EC=2.4.1.- ; Cell inner membrane Glycosyltransferase Transmembrane

Pubmed 12027885

 

prodomImg

pubmed

215

415

S=137 I=22 E=1.44651e-07

Putative polysaccharide syntase

Pubmed 18524407

 

prodomImg

sp_Pdown

sp|Q8PPR7|OPGH_XANAC

1

645

S=2977 I=89 E=0

Glucans biosynthesis glucosyltransferase H EC=2.4.1.- ; Cell inner membrane Glycosyltransferase Transmembrane

sp_Pdown

sp|Q3BXV7|OPGH_XANC5

1

645

S=2960 I=89 E=0

Glucans biosynthesis glucosyltransferase H EC=2.4.1.- ; Cell inner membrane Glycosyltransferase Transmembrane

sp_Pdown

sp|Q2NYU0|OPGH_XANOM

1

645

S=2903 I=87 E=0

Glucans biosynthesis glucosyltransferase H EC=2.4.1.- ; Cell inner membrane Glycosyltransferase Transmembrane

sp_Pdown

sp|Q83Z42|OPGH_XANEU

1

626

S=2889 I=90 E=0

Glucans biosynthesis glucosyltransferase H EC=2.4.1.- ; Cell inner membrane Glycosyltransferase Transmembrane

sp_Pdown

sp|Q8P532|OPGH_XANCP

1

645

S=2803 I=84 E=0

Glucans biosynthesis glucosyltransferase H EC=2.4.1.- ; Cell inner membrane Glycosyltransferase Transmembrane

Iprscan [MF_01072]

6

645

-

Iprscan IPR001173 [PF00535]

146

327

Glycosyl transferase, family 2

Iprscan [seg]

90

103

-

Iprscan [seg]

427

450

-

Iprscan [seg]

571

582

-

Iprscan [seg]

627

641

-

Iprscan [tmhmm]

62

84

-

Iprscan [tmhmm]

99

121

-

Iprscan [tmhmm]

417

439

-

Iprscan [tmhmm]

466

488

-

Iprscan [tmhmm]

554

576

-

Iprscan [tmhmm]

581

603

-

PD043927

312

521

S=541 I=52 E=5.58224e-58

PD857006

57

216

S=333 I=49 E=1.01528e-32

PDA8Y8N9

217

310

S=249 I=48 E=1.31929e-22

PD899977

522

626

S=233 I=43 E=1.39997e-20

PD442504

17

56

S=202 I=98 E=7.06839e-17

PDA1V9L7

291

312

S=117 I=100 E=1.50975e-06

Iprscan [SSF53448]

142

380

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jUHfDdFS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

66 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnf9fhb/XFF4834R_chr06290.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnf9fhb/XFF4834R_chr06290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnf9fhb/XFF4834R_chr06290.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnf9fhb/XFF4834R_chr06290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.