Xanthomonas fuscans subsp. fuscans

8 hits

  1. XFF4834R_chr07890lpxCXFF4834R_chr07890Probable UDP-3-O-acyl N-acetylglucosamine deacetylase
  2. XFF4834R_chr10400lpxHXFF4834R_chr10400UDP-2,3-diacylglucosamine hydrolase
  3. XFF4834R_chr11820XFF4834R_chr11820XFF4834R_chr11820Probable lipid A biosynthesis lauroyl acyltransferase
  4. XFF4834R_chr21940lpxKXFF4834R_chr21940probable tetraacyldisaccharide 4'-kinase
  5. XFF4834R_chr30860lpxDXFF4834R_chr30860probable UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
  6. XFF4834R_chr30880lpxAXFF4834R_chr30880probable Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
  7. XFF4834R_chr30890lpxBXFF4834R_chr30890probable Lipid-A-disaccharide synthase
  8. XFF4834R_chr36820XFF4834R_chr39990096_4260112_f2_XFF4834R-XFF4834R_chr36820XFF4834R_chr36820putative lipid A biosynthesis lauroyl acyltransferase

lpxC XFF4834R_chr07890
XFF4834R_chr07880
XFF4834R_chr07880
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07900
XFF4834R_chr07900
ID lpxC
AC XFF4834R_chr07890
LT XFF4834R_chr07890
OR XFF4834R_chr from 912399 to 913310 on strand +
DE Probable UDP-3-O-acyl N-acetylglucosamine deacetylase
IP UDP-3-O-acyl N-acetylglucosamine deacetylase
CL 1.6.3.3 Lipid A GO:0009245
EC
GO InterPro
Biological Process: lipid A biosynthetic process (GO:0009245)
Molecular Function: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity (GO:0008759)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100820)
MW 33586.1 Da
SQ 303 aa
 
........10........20........30........40........50
| | | | |
MTQQRTLKNTIRATGVGLHSGDKVYMTLRPAPVDHGVVFRRVDLEPVVEV
PADAELVTETTLCTGLTCNGAKIQTVEHLMSALAGLGVDNVIVELSSAEL
PIMDGSSGPFVFLLQSAGIVEQNKPKRFIRIRQTVEVRDGDKVARFEPYE
GYKLGFTIEFNHPMIPAKQSRQEIEFSTSAYVKEISRARTFGFMRDLEYM
RERNLGLGGSMDNAIVLDEFRVLNEDGLRYTNEFVRHKILDAIGDLYLAG
GAILGAYEGFKSGHALNNKLVRALLADQAAWEWVSFPEGTEQPPVTYASP
VYA
Show or not Domain decomposition
 
XFF4834R

YP_362567.1 lcl|lpxC-XCV0836

1

303

S=1608 I=99 E=0

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

XFF4834R

NP_641137.2 lcl|lpxC-XAC0785

1

303

S=1604 I=99 E=0

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

XFF4834R

NP_636122.1 lcl|lpxC-XCC0731

1

303

S=1593 I=98 E=0

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

XFF4834R

lcl|lpxC-XALc_2808

1

286

S=1391 I=90 E=1.44263e-161

probable udp-3-o-[3-hydroxymyristoyl] n-acetylglucosamine deacetylase protein

pubmed

1

303

S=1048 I=62 E=2.57889e-118

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

Pubmed 9068651

 

prodomImg

pubmed

1

300

S=1003 I=59 E=7.77153e-113

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

Pubmed 12153713

 

prodomImg

pubmed

1

300

S=970 I=58 E=6.22864e-109

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

Pubmed 20088879

 

prodomImg

pubmed

1

300

S=970 I=58 E=6.22864e-109

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

Pubmed 2824434,1630901

 

prodomImg

pubmed

1

302

S=791 I=45 E=3.75292e-87

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

Pubmed 10988064

 

prodomImg

sp_Pdown

sp|Q3BXE6|LPXC_XANC5

1

303

S=1608 I=99 E=0

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

sp_Pdown

sp|Q8PPA3|LPXC_XANAC

1

303

S=1604 I=99 E=0

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

sp_Pdown

sp|Q5GW46|LPXC_XANOR

1

303

S=1594 I=98 E=0

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

sp_Pdown

sp|B2SNZ9|LPXC_XANOP

1

303

S=1594 I=98 E=0

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

sp_Pdown

sp|Q2NZC4|LPXC_XANOM

1

303

S=1594 I=98 E=0

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase EC=3.5.1.- ; Hydrolase Lipid biosynthesis

Iprscan IPR015870 [G3DSA:3.30.230.20]

2

126

UDP-3-O-acyl N-acetylglucosamine deacetylase, N-terminal

Iprscan IPR011334 [G3DSA:3.30.1700.10]

128

282

UDP-3-O-acyl N-acetylglucosamine deacetylase, C-terminal

Iprscan IPR004463 [MF_00388]

2

280

UDP-3-O-acyl N-acetylglucosamine deacetylase

Iprscan IPR004463 [PF03331]

3

278

UDP-3-O-acyl N-acetylglucosamine deacetylase

Iprscan IPR004463 [TIGR00325]

1

303

UDP-3-O-acyl N-acetylglucosamine deacetylase

PDA0V1V9

135

278

S=480 I=63 E=1.09234e-50

PD011499

62

135

S=255 I=64 E=2.12666e-23

PDA038C6

3

61

S=198 I=63 E=1.7915e-16

PDA043J7

137

186

S=177 I=58 E=4.91728e-14

PDA1T9L1

279

303

S=135 I=100 E=7.44156e-09

PDA038C7

139

288

S=134 I=33 E=9.09397e-09

PDA21176

217

274

S=117 I=41 E=9.07879e-07

PDA7F2H8

136

186

S=115 I=43 E=1.79216e-06

PDA195N9

134

272

S=106 I=25 E=2.02313e-05

Iprscan IPR020568 [SSF54211]

133

293

Ribosomal protein S5 domain 2-type fold

Iprscan IPR020568 [SSF54211]

2

125

Ribosomal protein S5 domain 2-type fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YG9vTNEV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

318 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr07890.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr07890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr07890.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr07890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
lpxH XFF4834R_chr10400
XFF4834R_chr_1125
XFF4834R_chr_1125
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10410
XFF4834R_chr10410
ID lpxH
AC XFF4834R_chr10400
LT XFF4834R_chr10400
OR XFF4834R_chr from 1181037 to 1181780 on strand -
DE UDP-2,3-diacylglucosamine hydrolase
IP Metallophosphoesterase
CL 1.6.3.3 Lipid A GO:0009245
EC
GO InterPro
Biological Process: lipid A biosynthetic process (GO:0009245)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: pyrophosphatase activity (GO:0016462)

Curated
PM
AN 41 codons deleted to fit with other Xanthomonadaceae. Not sure if this is really lpxH, as suggested by iANT automatic annotation. PRK05340: UDP-2,3-diacylglucosamine hydrolase. TIGR01854: This model represents LpxH, UDP-2,3-diacylglucosamine hydrolase, and essential enzyme in E. coli that catalyzes the fourth step in lipid A biosynthesis. Note that Pseudomonas aeruginosa has both a member of this family that shares this function and a more distant homolog, designated LpxH2, that does not. Many species that produce lipid A lack an lpxH gene in this family; some of those species have an lpxH2 gene instead, although for which the function is unknown. Original annotation: UDP-2,3-diacylglucosamine pyrophosphatase.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20100722)
MW 26923.1 Da
SQ 247 aa
 
........10........20........30........40........50
| | | | |
MTTLFISDLHLDPARPAITELFLEFLRTQVPGSDALYILGDLFEAWIGDD
TPSTAADAVAVALHAVAGSGVPVFFMAGNRDFLVGETYAQRAGFRILPDP
TVIDLYGHTTLLMHGDLLCTDDTAYQAFRAQTRDPVFQAQFLAQPLAARV
AFAQQARAASQARHAELKQGDQSRFETVTDVSPAEVEATFVRYGLDRLIH
GHTHRPAIHTLQAGGNTCTRIVLGDWYEQGSVLRVDADGVSLEQLAL
Show or not Domain decomposition
 
XFF4834R

YP_362797.1 lcl|XCV1066

1

247

S=1024 I=83 E=3.94339e-117

UDP-2,3-diacylglucosamine hydrolase

XFF4834R

NP_641383.1 lcl|XAC1036-XAC1036

1

247

S=1014 I=82 E=6.42024e-116

UDP-2,3-diacylglucosamine hydrolase

XFF4834R

NP_636343.1 lcl|XCC0957

1

247

S=967 I=75 E=2.69471e-110

UDP-2,3-diacylglucosamine hydrolase

XFF4834R

lcl|lpxH-XALc_0569

1

245

S=784 I=62 E=4.16323e-88

probable udp-2,3-diacylglucosamine hydrolase protein

pubmed

1

242

S=499 I=42 E=6.00442e-52

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

Pubmed 12000770

 

prodomImg

sp_Pdown

sp|P58975|LPXH_XANAC

1

247

S=1014 I=82 E=1.7576e-114

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

sp_Pdown

sp|Q5GWJ5|LPXH_XANOR

1

247

S=984 I=79 E=6.59753e-111

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

sp_Pdown

sp|B2SMK4|LPXH_XANOP

1

247

S=984 I=79 E=6.59753e-111

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

sp_Pdown

sp|Q2NZQ3|LPXH_XANOM

1

247

S=984 I=79 E=6.59753e-111

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

sp_Pdown

sp|P58976|LPXH_XANCP

1

247

S=967 I=75 E=7.37702e-109

UDP-2,3-diacylglucosamine hydrolase EC=3.6.1.- ; Cytoplasm Lipid biosynthesis

Iprscan [G3DSA:3.60.21.10]

1

211

-

Iprscan [MF_00575]

1

247

-

Iprscan IPR004843 [PF00149]

1

206

Metallophosphoesterase

Iprscan IPR010138 [TIGR01854]

3

240

UDP-2,3-diacylglucosamine hydrolase

Iprscan [seg]

55

67

-

Iprscan [seg]

137

165

-

PDA061K5

168

243

S=237 I=57 E=2.72112e-21

PD038423

1

97

S=203 I=43 E=4.30508e-17

PDA1F9R1

98

135

S=150 I=74 E=9.06661e-11

Iprscan [SSF56300]

1

239

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 7TbwATfW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

161 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr10400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr10400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr10400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr10400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr11820 XFF4834R_chr11820
XFF4834R_chr11810
XFF4834R_chr11810
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11830
XFF4834R_chr11830
ID XFF4834R_chr11820
AC XFF4834R_chr11820
LT XFF4834R_chr11820
OR XFF4834R_chr from 1325222 to 1326142 on strand -
DE Probable lipid A biosynthesis lauroyl acyltransferase
IP Bacterial lipid A biosynthesis acyltransferase
CL 1.6.3.3 Lipid A GO:0009245
EC
GO InterPro
Biological Process: lipopolysaccharide core region biosynthetic process (GO:0009244)
Cellular Component: Gram-negative-bacterium-type cell wall (GO:0009276)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: acyltransferase activity (GO:0008415)
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100827)
MW 34947.2 Da
SQ 306 aa
 
........10........20........30........40........50
| | | | |
MSEPANVAVRPSLRNPKHWPMYLGLAVMVVAGRLPWTLQRAVGRGVGWLA
MRLAGTRRRAAEVNLELCFPEQDDAWRARLLRDSFDALGVGLFEFARAWW
GSIDAIRPGVQIEGLEHLQQLQQQKRGVLLVSGHFMTLEMCGRLLCDHVP
LAGMYRRHRNPVFEWAVKRGRLRYATHMFANEDLRATIKHLKRGGFLWYA
PDQDMRGKDTVFVPFFGHPASTITATHQLARLTGCAVVPYFHRREGGRYI
LKIAPPLADIPSDDVIADTTQVNAAIEDMVREAPDQYLWIHRRFKRQPGG
RSAFYR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr36820 XFF4834R_chr39990096_4260112_f2_XFF4834R-XFF4834R_chr36820

26

300

S=287 I=30 E=2.95035e-28

XFF4834R

NP_643772.1 htrB-XAC3465

1

306

S=1558 I=96 E=0

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

YP_365324.1 waaM-XCV3593

1

306

S=1553 I=96 E=0

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

NP_638684.1 htrB-XCC3338

1

306

S=1517 I=93 E=1.02633e-176

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

XALc_0745 waaM-XALc_0745

2

305

S=1182 I=74 E=4.00519e-136

probable lipid a biosynthesis lauroyl acyltransferase protein

XFF4834R

YP_365645.1 htrB-XCV3914

26

300

S=292 I=30 E=2.62764e-28

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

NP_644096.1 htrB-XAC3790

26

300

S=292 I=30 E=2.74473e-28

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

NP_639083.1 htrB-XCC3738

32

300

S=287 I=30 E=9.22196e-28

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

XALc_2848 HtrB-XALc_2848

32

298

S=250 I=29 E=2.73329e-23

putative lauroyl/myristoyl acyltransferase, lipid a biosynthesis protein

pubmed

10

306

S=547 I=38 E=1.39856e-57

Lipid A biosynthesis lauroyl acyltransferase EC=2.3.1.-

Pubmed 18459973

 

prodomImg

pubmed

12

305

S=535 I=38 E=4.1195e-56

Lipid A biosynthesis lauroyl acyltransferase EC=2.3.1.- ; Cell inner membrane Lipopolysaccharide Stress response Transmembrane

Pubmed 1840644

 

prodomImg

pubmed

10

302

S=459 I=34 E=6.60447e-47

Lipid A biosynthesis lauroyl acyltransferase EC=2.3.1.- ; Cell inner membrane Lipopolysaccharide Stress response Transmembrane

Pubmed 7592970

 

prodomImg

pubmed

27

305

S=416 I=33 E=9.99486e-42

Lipid A acyl transferase

Pubmed 11796626

 

prodomImg

pubmed

27

305

S=408 I=33 E=9.89982e-41

Acyl-transferase MsbB

Pubmed 11796626

 

prodomImg

sp_Pdown

acc=P0ACV0

12

305

S=535 I=38 E=2.80648e-56

Lipid A biosynthesis lauroyl acyltransferase EC=2.3.1.- ; Cell inner membrane Lipopolysaccharide Stress response Transmembrane

sp_Pdown

acc=P0ACV1

12

305

S=535 I=38 E=2.80648e-56

Lipid A biosynthesis lauroyl acyltransferase EC=2.3.1.- ; Cell inner membrane Lipopolysaccharide Stress response Transmembrane

sp_Pdown

acc=P0ACV3

15

305

S=485 I=35 E=2.65013e-50

Protein ddg ; Acyltransferase Cell inner membrane Transmembrane

sp_Pdown

acc=P0ACV2

15

305

S=485 I=35 E=2.65013e-50

Protein ddg ; Acyltransferase Cell inner membrane Transmembrane

sp_Pdown

acc=P45239

10

302

S=459 I=34 E=4.49942e-47

Lipid A biosynthesis lauroyl acyltransferase EC=2.3.1.- ; Cell inner membrane Lipopolysaccharide Stress response Transmembrane

Iprscan IPR004960 [PF03279]

10

296

Bacterial lipid A biosynthesis acyltransferase

Iprscan IPR011920 [TIGR02207]

7

305

Lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase

Iprscan [seg]

118

124

-

Iprscan [SignalP-NN(euk)]

1

31

-

PD011612

180

299

S=240 I=47 E=1.47896e-21

PD191353

17

184

S=237 I=36 E=3.18544e-21

PDA1T7F2

1

33

S=163 I=97 E=3.02672e-12

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6fqy7zFb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

57 hits
swiss-prot

Swiss-Prot ncbi-blastp

9 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr11820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr11820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr11820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr11820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
lpxK XFF4834R_chr21940
XFF4834R_chr21930
XFF4834R_chr21930
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21950
XFF4834R_chr21950
ID lpxK
AC XFF4834R_chr21940
LT XFF4834R_chr21940
OR XFF4834R_chr from 2540578 to 2541615 on strand +
DE probable tetraacyldisaccharide 4'-kinase
IP Tetraacyldisaccharide 4'-kinase
CL 1.6.3.3 Lipid A GO:0009245
EC
GO InterPro
Biological Process: lipid A biosynthetic process (GO:0009245)
Molecular Function: tetraacyldisaccharide 4'-kinase activity (GO:0009029)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN other name : lipid A 4'kinase
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100825)
MW 37515.7 Da
SQ 345 aa
 
........10........20........30........40........50
| | | | |
MSKRGTRTPGYWYDNTPIPLPARILAPVYGAAIALRRALYRRGWRRRHGV
PVPVVVVGNVTAGGTGKTPLTIALVAKLQEAGWTPGVASRGYGRDDAGTA
RWVEADTPVALGGDEPVLIAWKTGARVRVDSDRLAAARALVEAGCDIVIC
DDGLQHYRLARDVEIEVVDGQRRYGNGRLLPAGPLREPAARAHDCDFRVV
NLGQASATAAPQAPDDAGFGEWQMRLSIDSVQPMDGKRAQPLSMLAGQRV
HAVAGIAHPERFFAMLRARSIGVVPHAFPDHHVYRAADFSFGSRLPVLMT
EKDAVKCRPFADEWLYSVPLKAELPAAFWVSLLDRLNKLASRQGV
Show or not Domain decomposition
 
XFF4834R

YP_363986.1 lpxK-XCV2255

1

345

S=1544 I=88 E=6.37179e-180

tetraacyldisaccharide 4'-kinase

XFF4834R

NP_642409.1 lpxK-XAC2088

1

345

S=1533 I=88 E=1.27885e-178

tetraacyldisaccharide 4'-kinase

XFF4834R

NP_637480.1 lpxK-XCC2119

1

343

S=1413 I=80 E=4.28403e-164

tetraacyldisaccharide 4'-kinase

XFF4834R

XALc_1814 lpxK-XALc_1814

2

344

S=1084 I=64 E=3.1897e-124

probable tetraacyldisaccharide 4prime-kinase (lipid a 4prime-kinase) protein

pubmed

67

342

S=484 I=43 E=6.20863e-50

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

Pubmed 20091296

 

prodomImg

pubmed

67

341

S=413 I=43 E=2.44547e-41

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

Pubmed 20088879

 

prodomImg

pubmed

67

341

S=413 I=43 E=2.44547e-41

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

Pubmed 8094880

 

prodomImg

pubmed

67

316

S=350 I=34 E=1.10835e-33

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

Pubmed 7881549

 

prodomImg

pubmed

67

338

S=266 I=32 E=1.46556e-23

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

Pubmed 19145256

 

prodomImg

sp_Pdown

acc=Q3BTC7

1

345

S=1544 I=88 E=1.81702e-178

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

sp_Pdown

acc=Q8PKS4

1

345

S=1533 I=88 E=3.64684e-177

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

sp_Pdown

acc=Q5H0H1

1

345

S=1500 I=86 E=3.16142e-173

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

sp_Pdown

acc=B2SKI3

1

345

S=1500 I=86 E=3.16142e-173

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

sp_Pdown

acc=Q2P3E8

1

345

S=1500 I=86 E=3.16142e-173

Tetraacyldisaccharide 4'-kinase EC=2.7.1.130 ; ATP-binding Lipid biosynthesis Nucleotide-binding Transferase

Iprscan IPR003758 [MF_00409]

7

341

Tetraacyldisaccharide 4'-kinase

Iprscan IPR003758 [PF02606]

22

336

Tetraacyldisaccharide 4'-kinase

Iprscan IPR003758 [TIGR00682]

25

342

Tetraacyldisaccharide 4'-kinase

Iprscan [seg]

29

66

-

PD225953

67

324

S=501 I=48 E=2.84109e-53

PDA1W1J5

188

247

S=260 I=82 E=4.80305e-24

PDA1W1J2

311

345

S=177 I=100 E=4.88934e-14

PD352108

252

310

S=154 I=56 E=3.68973e-11

PDA1W1J4

1

28

S=134 I=93 E=9.36321e-09

PDA3F8O3

245

313

S=120 I=35 E=4.86084e-07

PDA1W1J1

311

341

S=109 I=58 E=1.03699e-05

Iprscan [SSF52540]

51

209

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one sYMAenHz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

361 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr21940.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr21940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr21940.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr21940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
lpxD XFF4834R_chr30860
XFF4834R_chr30850
XFF4834R_chr30850
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30870
XFF4834R_chr30870
ID lpxD
AC XFF4834R_chr30860
LT XFF4834R_chr30860
OR XFF4834R_chr from 3550696 to 3551709 on strand +
DE probable UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
IP UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
CL 1.6.3.3 Lipid A GO:0009245
EC
GO InterPro
Biological Process: lipid A biosynthetic process (GO:0009245)
Molecular Function: transferase activity (GO:0016740)
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100705)
MW 34945.6 Da
SQ 337 aa
 
........10........20........30........40........50
| | | | |
MRLTASAIAEQFGLTVVGDGTTEVSGVATLAHAGAGQLSFLSNPRYRPQL
ADTQAAVVVLRADDAEAAKGTALVAKDPYTAFAKIAALFDVAPVREPGIH
ASAVIDPTAQVSATAHVGPFVSIGARSRVGDGCVIGTGSIIGEDCVVDAG
SELLARVTLVTRVRLGKRVRIHPGAVIGADGFGLAMDAGHWIKVPQLGGV
VIGDDCEIGANTCIDRGALEDTVLEEDVRVDNLVQIAHNCRIGAHSAIAG
CTGIAGSAKIGRYCLLGGHVGVVGHLEICDKVVITGKSVVRNSIHEPGEY
SSGTPLTDNRTWRKNAVRFKQLDALARRILAVGKEKE
XFF4834R

NP_641746.1 lcl|lpxD-XAC1411

1

337

S=1649 I=96 E=0

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase

XFF4834R

YP_363199.1 lcl|lpxD-XCV1468

1

337

S=1630 I=95 E=0

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase

XFF4834R

NP_636737.1 lcl|lpxD-XCC1363

1

337

S=1558 I=90 E=0

UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase

XFF4834R

lcl|lpxD-XALc_2035

4

336

S=1339 I=77 E=3.74779e-155

probable udp-3-o-(3-hydroxymyristo yl)-glucosamine n-acyltransferase protein

XFF4834R

lcl|lpxA-XALc_2037

99

142

S=118 I=60 E=3.25481e-07

probable udp-n-acetylglucosamine acyltransferase protein

pubmed

8

335

S=714 I=45 E=8.64139e-78

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Antibiotic resistance Lipid biosynthesis Repeat

Pubmed 2256935,2009853

 

prodomImg

pubmed

8

335

S=707 I=43 E=6.14536e-77

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Antibiotic resistance Lipid biosynthesis Repeat

Pubmed 1987124

 

prodomImg

pubmed

8

335

S=675 I=44 E=4.32152e-73

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Lipid biosynthesis Repeat

Pubmed 8293817

 

prodomImg

pubmed

8

337

S=647 I=43 E=1.02191e-69

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Lipid biosynthesis Repeat

Pubmed 7642134

 

prodomImg

pubmed

3

335

S=622 I=40 E=1.34739e-66

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Lipid biosynthesis Repeat

Pubmed 9197543

 

prodomImg

sp_Pdown

sp|Q8PML5|LPXD_XANAC

1

337

S=1649 I=96 E=0

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Lipid biosynthesis Repeat

sp_Pdown

sp|Q3BVL4|LPXD_XANC5

1

337

S=1630 I=95 E=0

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Lipid biosynthesis Repeat

sp_Pdown

sp|Q5H1F0|LPXD_XANOR

1

337

S=1587 I=92 E=0

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Lipid biosynthesis Repeat

sp_Pdown

sp|Q2P4B5|LPXD_XANOM

1

337

S=1567 I=91 E=0

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Lipid biosynthesis Repeat

sp_Pdown

sp|Q8PAW3|LPXD_XANCP

1

337

S=1558 I=90 E=3.21536e-180

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase EC=2.3.1.- ; Lipid biosynthesis Repeat

Iprscan [G3DSA:2.160.10.10]

110

307

-

Iprscan IPR007691 [MF_00523]

8

325

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase

Iprscan [PTHR22572]

95

212

-

Iprscan IPR020573 [PF04613]

21

89

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, non-repeat region

Iprscan IPR007691 [TIGR01853]

7

329

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase

Iprscan [seg]

265

276

-

PDA1K9W3

138

173

S=168 I=94 E=7.32569e-13

PD289333

4

73

S=155 I=46 E=2.3958e-11

PD004893

285

337

S=143 I=53 E=6.75589e-10

PDA1G8R1

177

219

S=127 I=63 E=5.47118e-08

PDA332F5

75

98

S=121 I=96 E=3.69254e-07

PDA5H5D8

174

261

S=120 I=36 E=4.17192e-07

PDA332F4

75

98

S=116 I=96 E=1.33028e-06

PDA1F3U5

99

155

S=115 I=39 E=1.62567e-06

PDA189A2

77

138

S=114 I=39 E=2.16763e-06

PDA7D6C6

75

98

S=114 I=96 E=2.58057e-06

Iprscan IPR011004 [SSF51161]

97

331

Trimeric LpxA-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one McZXgT1f)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

422 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
lpxA XFF4834R_chr30880
XFF4834R_chr30870
XFF4834R_chr30870
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30890
XFF4834R_chr30890
ID lpxA
AC XFF4834R_chr30880
LT XFF4834R_chr30880
OR XFF4834R_chr from 3552190 to 3552981 on strand +
DE probable Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
IP Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
CL 1.6.3.3 Lipid A GO:0009245
EC
GO InterPro
Biological Process: lipid biosynthetic process (GO:0008610)
Molecular Function: transferase activity (GO:0016740)
Molecular Function: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity (GO:0008780)

Curated
PM
AN Pubmed 9197543; Pubmed 3277952
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100705)
MW 27864.3 Da
SQ 263 aa
 
........10........20........30........40........50
| | | | |
MRDSTPLIHPTAVIDPSATLADDVRVGAFSLIGADVQIGAGTEVGPHCSI
HGPTRIGRNNRFIGHAAIGGEPQDKKYAGERTELVIGDGNVIREFVTINR
GTGGGGGITVVGNDNWMLAYTHVAHDCHVGNHCVFSNNTTLAGHVTVGDY
VIISGFAGAHQFCRIGAHAFLGMGALTNGDVPPFTMVGSESLGRPRGINS
EGLKRRGFDAERITAIKRAYRTLYVAGLPLADAKLQLAEQAKSSDDVRGM
LEFIEAAERPLLR
XFF4834R

NP_641744.1 lcl|lpxA-XAC1409

1

263

S=1276 I=93 E=1.03909e-147

UDP-N-acetylglucosamine acyltransferase

XFF4834R

YP_363197.1 lcl|lpxA-XCV1466

1

263

S=1269 I=92 E=9.43279e-147

UDP-N-acetylglucosamine acyltransferase

XFF4834R

NP_636735.1 lcl|lpxA-XCC1361

1

263

S=1214 I=88 E=3.32283e-140

UDP-N-acetylglucosamine acyltransferase

XFF4834R

lcl|lpxA-XALc_2037

1

263

S=1012 I=73 E=1.1836e-115

probable udp-n-acetylglucosamine acyltransferase protein

XFF4834R

lcl|lpxD-XALc_2035

8

68

S=108 I=38 E=4.10213e-06

probable udp-3-o-(3-hydroxymyristo yl)-glucosamine n-acyltransferase protein

pubmed

7

263

S=647 I=47 E=7.41509e-70

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase EC=2.3.1.129 ; Cytoplasm Lipid biosynthesis Repeat

Pubmed 9197543

 

prodomImg

pubmed

7

263

S=639 I=47 E=6.97025e-69

UDP-N-acetylglucosamine O-acyltransferase ; Cytoplasm Lipid biosynthesis Repeat

Pubmed 13129607

 

prodomImg

pubmed

7

263

S=546 I=45 E=1.39948e-57

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase EC=2.3.1.129 ; Cytoplasm Lipid biosynthesis Repeat

Pubmed 9440522

 

prodomImg

pubmed

1

263

S=545 I=42 E=1.88238e-57

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase EC=2.3.1.129 ; Cytoplasm Lipid biosynthesis Repeat

Pubmed 8293817

 

prodomImg

pubmed

1

263

S=534 I=41 E=3.46258e-56

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase EC=2.3.1.129 ; Cytoplasm Lipid biosynthesis Repeat

Pubmed 3277952

 

prodomImg

sp_Pdown

sp|Q8PML7|LPXA_XANAC

1

263

S=1276 I=93 E=2.89917e-146

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase EC=2.3.1.129 ; Cytoplasm Lipid biosynthesis Repeat

sp_Pdown

sp|Q3BVL6|LPXA_XANC5

1

263

S=1269 I=92 E=2.63184e-145

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase EC=2.3.1.129 ; Cytoplasm Lipid biosynthesis Repeat

sp_Pdown

sp|Q5H1F2|LPXA_XANOR

1

263

S=1227 I=90 E=2.83482e-140

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase EC=2.3.1.129 ; Cytoplasm Lipid biosynthesis Repeat

sp_Pdown

sp|B2SR11|LPXA_XANOP

1

263

S=1227 I=90 E=2.83482e-140

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase EC=2.3.1.129 ; Cytoplasm Lipid biosynthesis Repeat

sp_Pdown

sp|Q2P4B7|LPXA_XANOM

1

263

S=1227 I=90 E=2.83482e-140

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase EC=2.3.1.129 ; Cytoplasm Lipid biosynthesis Repeat

Iprscan [G3DSA:1.20.1180.10]

198

263

-

Iprscan [G3DSA:2.160.10.10]

7

187

-

Iprscan IPR010137 [PIRSF000456]

3

263

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase

Iprscan [PTHR23416]

123

175

-

Iprscan [PTHR23416:SF7]

123

175

-

Iprscan IPR010137 [TIGR01852]

8

262

Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase

PD386210

114

172

S=203 I=56 E=4.6312e-17

PDA1F3U5

8

57

S=142 I=54 E=1.17034e-09

PD007405

186

259

S=125 I=44 E=1.29725e-07

PD759594

66

95

S=109 I=73 E=1.14627e-05

Iprscan IPR011004 [SSF51161]

1

263

Trimeric LpxA-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9cPbL4h0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

52 hits
swiss-prot

Swiss-Prot ncbi-blastp

296 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30880.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30880.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
lpxB XFF4834R_chr30890
XFF4834R_chr30880
XFF4834R_chr30880
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30900
XFF4834R_chr30900
ID lpxB
AC XFF4834R_chr30890
LT XFF4834R_chr30890
OR XFF4834R_chr from 3553011 to 3554282 on strand +
DE probable Lipid-A-disaccharide synthase
IP Glycosyl transferase, family 19
CL 1.6.3.3 Lipid A GO:0009245
EC
GO InterPro
Biological Process: lipid A biosynthetic process (GO:0009245)
Molecular Function: lipid-A-disaccharide synthase activity (GO:0008915)

Curated
PM
AN Pubmed 8917090
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100827)
MW 45696.4 Da
SQ 423 aa
 
........10........20........30........40........50
| | | | |
MQSVHTTPGEVVHDALANPQSAIPNLRAPRIALIAGEASGDSLGAGLIEQ
LRLRYPNAEFVGIGGDAMRGAGCQTWFDASELAVMGLTEVLRHLPRLLKL
RSAFRERVLAWKPDVFIGIDAPDFNLPVERWLKQRGIKTVHYVSPSVWAW
REKRAEKIGVSADLVLCLFPMEPPIYAKHGVDARFVGHPMADDIAYQADR
AAARATLGLSASSTVLAVLPGSRHGEISRLGDTFFQAAWLVSEHLPNLHV
LVPAANPGCKHLLAEQLSRSSLPVMRSHLLDGQARTAMLAADVVLLASGT
ATLEAMLVKRPMVVGYKVAPLTYRIVKLLGLLKVNRYALPNILANDDLAP
ELMQDDCTPERLCVALLDWFNHPDKVAALQPRYLALHAELRCDASARAAD
AVAGLLEGRESGVGIGDSAGAMA
Show or not Domain decomposition
 
XFF4834R

YP_363196.1 lpxB-XCV1465

15

423

S=1832 I=88 E=0

lipid-A-disaccharide synthase

XFF4834R

NP_641743.1 lpxB-XAC1408

12

423

S=1828 I=88 E=0

lipid-A-disaccharide synthase

XFF4834R

NP_636734.1 lpxB-XCC1360

26

421

S=1764 I=86 E=0

lipid-A-disaccharide synthase

XFF4834R

XALc_2038 lpxB-XALc_2038

27

408

S=1297 I=72 E=5.39383e-150

probable lipid a disaccharide synthetase protein

pubmed

25

411

S=881 I=47 E=6.00236e-98

Lipid-A-disaccharide synthase EC=2.4.1.182 ; Glycosyltransferase biosynthesis

Pubmed 8917090

 

prodomImg

pubmed

31

393

S=804 I=46 E=1.58178e-88

Lipid-A-disaccharide synthase EC=2.4.1.182 ; Glycosyltransferase biosynthesis

Pubmed 2824445

 

prodomImg

sp_Pdown

acc=Q3BVL7

15

423

S=1832 I=88 E=0

Lipid-A-disaccharide synthase EC=2.4.1.182 ; Glycosyltransferase biosynthesis

sp_Pdown

acc=Q8PML8

12

423

S=1829 I=88 E=0

Lipid-A-disaccharide synthase EC=2.4.1.182 ; Glycosyltransferase biosynthesis

sp_Pdown

acc=Q8PAW6

5

421

S=1770 I=83 E=0

Lipid-A-disaccharide synthase EC=2.4.1.182 ; Glycosyltransferase biosynthesis

sp_Pdown

acc=Q4USP7

5

421

S=1770 I=83 E=0

Lipid-A-disaccharide synthase EC=2.4.1.182 ; Glycosyltransferase biosynthesis

sp_Pdown

acc=Q5H1F3

27

415

S=1744 I=87 E=0

Lipid-A-disaccharide synthase EC=2.4.1.182 ; Glycosyltransferase biosynthesis

Iprscan [MF_00392]

28

407

-

Iprscan IPR003835 [PF02684]

31

372

Glycosyl transferase, family 19

Iprscan IPR003835 [TIGR00215]

24

405

Glycosyl transferase, family 19

Iprscan [seg]

191

205

-

Iprscan [seg]

394

403

-

PD014237

138

407

S=474 I=41 E=5.49651e-50

PD231234

30

135

S=326 I=61 E=5.04971e-32

Iprscan [SSF53756]

27

314

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 42TJKLFC)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

257 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30890.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30890.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTPd6rQ/XFF4834R_chr30890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr39990096_4260112_f2_XFF4834R-XFF4834R_chr36820 XFF4834R_chr36820
XFF4834R_chr36810
XFF4834R_chr36810
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36830
XFF4834R_chr36830
ID XFF4834R_chr39990096_4260112_f2_XFF4834R-XFF4834R_chr36820
AC XFF4834R_chr36820
LT XFF4834R_chr36820
OR XFF4834R_chr from 4259096 to 4260112 on strand +
DE putative lipid A biosynthesis lauroyl acyltransferase
IP Bacterial lipid A biosynthesis acyltransferase
CL 1.6.3.3 Lipid A GO:0009245
EC
GO InterPro
Biological Process: lipopolysaccharide core region biosynthetic process (GO:0009244)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: acyltransferase activity (GO:0008415)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100817)
MW 37349.4 Da
SQ 338 aa
 
........10........20........30........40........50
| | | | |
MGILGHQTVPRSMPSAAGTVTRGPSRSALFRIARMTPDVRARLLYATAAA
VGRLPWLLLKRVADTLAWSWRKLNARESRVARRNLELAYPELSAEQRARL
HAQILRSTARQTLEVLRTWTRPPAENLARLQRNGQELYDAALASGRGVIV
AAPHFGNWELLNQWLSERGPIAIVYRPPESEAVDGFLQLARGGDNVRQVR
AEGPAVRQLFKVLKDGGAVGILPDQQPKMGDGVFAPFFGIPALTMTLVNR
LAERTGAIVLYGWCERVGDDLQFALHVQPADPAVADADPVRAASALNAGI
EQIARRDPAQYQWTYKRYTLRPPGSGEANPYATERHPH
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr11820 lcl|lpxL-XFF4834R_chr11820

46

324

S=261 I=29 E=3.81021e-25

lauryl-acyl carrier protein (ACP)-dependent acyltransferase

XFF4834R

YP_365645.1 lcl|htrB-XCV3914

1

338

S=1587 I=92 E=0

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

NP_644096.1 lcl|htrB-XAC3790

35

338

S=1446 I=92 E=4.00753e-168

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

NP_639083.1 lcl|htrB-XCC3738

35

338

S=1402 I=89 E=9.96887e-163

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

lcl|HtrB-XALc_2848

35

338

S=1097 I=71 E=9.0933e-126

putative lauroyl/myristoyl acyltransferase, lipid a biosynthesis protein

XFF4834R

NP_638684.1 lcl|htrB-XCC3338

46

327

S=273 I=29 E=5.69964e-26

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

lcl|waaM-XALc_0745

55

324

S=261 I=29 E=1.46025e-24

probable lipid a biosynthesis lauroyl acyltransferase protein

XFF4834R

NP_643772.1 lcl|htrB-XAC3465

46

324

S=255 I=29 E=8.87634e-24

lipid A biosynthesis lauroyl acyltransferase

XFF4834R

YP_365324.1 lcl|waaM-XCV3593

46

327

S=254 I=28 E=1.08473e-23

lipid A biosynthesis lauroyl acyltransferase

pubmed

73

318

S=380 I=37 E=2.81972e-37

Uvs111

Pubmed 14532085

 

prodomImg

pubmed

36

322

S=370 I=28 E=3.72402e-36

Putative HtrB protein

Pubmed 11425734

 

prodomImg

pubmed

79

331

S=356 I=33 E=2.26181e-34

Putative lipid A biosynthetic acyltransferase

Pubmed 18337458

 

prodomImg

pubmed

79

331

S=355 I=33 E=2.74005e-34

Decanoyl transferase Putative lipid A biosynthetic acyltransferase

Pubmed 18337458,18795947

 

prodomImg

pubmed

79

331

S=354 I=33 E=3.40739e-34

Putative lipid A biosynthetic acyltransferase

Pubmed 18337458

 

prodomImg

sp_Pdown

sp|P0ACV3|DDG_SHIFL

73

324

S=205 I=28 E=2.81541e-16

Protein ddg ; Acyltransferase Cell inner membrane Transmembrane

sp_Pdown

sp|P0ACV2|DDG_ECOLI

73

324

S=205 I=28 E=2.81541e-16

Protein ddg ; Acyltransferase Cell inner membrane Transmembrane

sp_Pdown

sp|P0ACV0|HTRB_ECOLI

51

324

S=192 I=24 E=1.06786e-14

Lipid A biosynthesis lauroyl acyltransferase EC=2.3.1.- ; Cell inner membrane Lipopolysaccharide Stress response Transmembrane

sp_Pdown

sp|P0ACV1|HTRB_ECO57

51

324

S=192 I=24 E=1.06786e-14

Lipid A biosynthesis lauroyl acyltransferase EC=2.3.1.- ; Cell inner membrane Lipopolysaccharide Stress response Transmembrane

sp_Pdown

sp|P45239|HTRB_HAEIN

54

322

S=158 I=22 E=1.22362e-10

Lipid A biosynthesis lauroyl acyltransferase EC=2.3.1.- ; Cell inner membrane Lipopolysaccharide Stress response Transmembrane

Iprscan IPR004960 [PF03279]

46

318

Bacterial lipid A biosynthesis acyl