Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr36880XFF4834R_chr40030482_4266306_f1_XFF4834R-XFF4834R_chr36880XFF4834R_chr36880probable lipopolysaccharide core biosynthesis glycosyltransferase

XFF4834R_chr40030482_4266306_f1_XFF4834R-XFF4834R_chr36880 XFF4834R_chr36880
XFF4834R_chr36870
XFF4834R_chr36870
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36890
XFF4834R_chr36890
ID XFF4834R_chr40030482_4266306_f1_XFF4834R-XFF4834R_chr36880
AC XFF4834R_chr36880
LT XFF4834R_chr36880
OR XFF4834R_chr from 4265482 to 4266306 on strand +
DE probable lipopolysaccharide core biosynthesis glycosyltransferase
IP Glycosyl transferase, family 2
CL 1.6.3.2 Core region GO:0009244
EC
GO InterPro


Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100818)
MW 31220 Da
SQ 274 aa
 
........10........20........30........40........50
| | | | |
MSSSTAPDERPRICACIIAFNEADRLRDCLASLAFCDEIVVVDSGSTDAT
TAIASEYGARVLHRAFDGYRSQKAFCVAQASHDWVLCLDADERVSDALRT
SIIAARDAGFATAAGYRFARLSDYFGRFLRHGNAYPDRVLRLFDRRRGGW
RGKREIHEAASVDGPVETLAGDLIHYPYRSLMQQLTKTQRYAQMMAEHEH
ARGKRATWSKLVLAPAWRFWRGYLLRGGFRDGWHGLIYAYVRANYVRQKT
IMLWLLQNNQPVQDPPRAPDRRSQ
XFF4834R

YP_365652.1 lcl|waaE-XCV3921

1

274

S=1286 I=93 E=7.90594e-149

lipopolysaccharide core biosynthesis glycosyltransferase

XFF4834R

NP_644102.1 lcl|XAC3796-XAC3796

1

274

S=1241 I=90 E=1.93264e-143

lipopolysaccharide core biosynthesis glycosyl transferase

XFF4834R

NP_639089.1 lcl|XCC3744

1

273

S=1214 I=89 E=3.7397e-140

lipopolysaccharide core biosynthesis glycosyl transferase

XFF4834R

lcl|XALc_2852

13

259

S=300 I=34 E=2.09187e-29

putative glycosyltransferase protein

pubmed

9

271

S=412 I=37 E=2.37246e-41

WaaE

Pubmed 19151135

 

prodomImg

pubmed

9

271

S=412 I=38 E=2.6572e-41

WaaE

Pubmed 18310345

 

prodomImg

pubmed

10

259

S=391 I=39 E=8.6075e-39

Lipopolysaccharide core biosynthesis glycosyltransferase kdtX EC=2.4.-.-

Pubmed 8824620

 

prodomImg

pubmed

10

259

S=390 I=39 E=1.04275e-38

Glucosyl-transferase

Pubmed 12427940

 

prodomImg

pubmed

9

256

S=378 I=34 E=3.47021e-37

Glucosyl-transferase

Pubmed 12427940

 

prodomImg

sp_Pdown

sp|Q54435|KDTX_SERMA

10

259

S=391 I=39 E=5.86769e-39

Lipopolysaccharide core biosynthesis glycosyltransferase kdtX EC=2.4.-.-

sp_Pdown

sp|Q9XC90|WAAE_KLEPN

12

259

S=372 I=38 E=1.19739e-36

Lipopolysaccharide core biosynthesis glycosyltransferase waaE EC=2.4.-.-

sp_Pdown

sp|P44029|Y653_HAEIN

11

254

S=354 I=36 E=2.05245e-34

Uncharacterized glycosyltransferase HI_0653 EC=2.4.-.-

sp_Pdown

sp|Q9R9M9|LPSC_RHIME

13

245

S=304 I=33 E=2.28729e-28

Lipopolysaccharide core biosynthesis glycosyltransferase lpsC EC=2.4.-.-

sp_Pdown

sp|Q4UMM0|Y337_RICFE

11

242

S=218 I=28 E=5.51974e-18

Uncharacterized glycosyltransferase RF_0337 EC=2.4.-.-

Iprscan [G3DSA:3.90.550.10]

11

91

-

Iprscan [PTHR22916]

19

94

-

Iprscan IPR001173 [PF00535]

15

137

Glycosyl transferase, family 2

Iprscan [seg]

104

114

-

PDA999Y4

11

208

S=151 I=24 E=7.02334e-11

PD011199

135

206

S=146 I=42 E=3.4935e-10

PDA727W6

13

63

S=127 I=51 E=6.25505e-08

PD565990

13

95

S=117 I=34 E=1.04538e-06

PDA1U6V6

99

134

S=115 I=67 E=1.7793e-06

PD485005

211

260

S=109 I=44 E=8.32646e-06

PDA9C4F7

12

233

S=104 I=29 E=4.28868e-05

Iprscan [SSF53448]

11

91

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wJHMTnWG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

75 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwrKheL/XFF4834R_chr36880.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwrKheL/XFF4834R_chr36880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwrKheL/XFF4834R_chr36880.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwrKheL/XFF4834R_chr36880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.