Xanthomonas fuscans subsp. fuscans

10 hits

  1. XFF4834R_chr11810XFF4834R_chr12360840_1325129_f3_XFF4834R-XFF4834R_chr11810XFF4834R_chr11810Putative lipid a core-o-antigen ligase protein
  2. XFF4834R_chr15940gtrBXFF4834R_chr15940putative bactoprenol glucosyl transferase
  3. XFF4834R_chr22970XFF4834R_chr25090466_2663434_r3_XFF4834R-XFF4834R_chr22970XFF4834R_chr22970putative glycosyl transferase
  4. XFF4834R_chr28180XFF4834R_chr30730560_3250498_r3_XFF4834R-XFF4834R_chr28180XFF4834R_chr28180putative glycosyltransferase
  5. XFF4834R_chr34760rmlDXFF4834R_chr34760dTDP-4-dehydrorhamnose reductase
  6. XFF4834R_chr34770rmlCXFF4834R_chr34770dTDP-4-dehydrorhamnose 3,5-epimerase
  7. XFF4834R_chr34780rmlAXFF4834R_chr34780glucose-1-phosphate thymidylyltransferase
  8. XFF4834R_chr34790rmlBXFF4834R_chr34790dTDP-glucose 4,6-dehydratase
  9. XFF4834R_chr34920wxcBXFF4834R_chr34920LPS O-antigen biosynthesis tyrosine kinase
  10. XFF4834R_chr36890XFF4834R_chr_4266503_4267714_r3_XFF4834R-XFF4834R_chr36890XFF4834R_chr36890putative O-antigen ligase

XFF4834R_chr12360840_1325129_f3_XFF4834R-XFF4834R_chr11810 XFF4834R_chr11810
XFF4834R_chr11800
XFF4834R_chr11800
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11820
XFF4834R_chr11820
ID XFF4834R_chr12360840_1325129_f3_XFF4834R-XFF4834R_chr11810
AC XFF4834R_chr11810
LT XFF4834R_chr11810
OR XFF4834R_chr from 1323840 to 1325129 on strand +
DE Putative lipid a core-o-antigen ligase protein
IP O-antigen ligase-related
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro


Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100827)
MW 45884.2 Da
SQ 429 aa
 
........10........20........30........40........50
| | | | |
MTPDAGRWAPLWVIVFVALWPTPGLAETVLSLGALFAAYRLLHARFRGGT
RLLSGAAWALTSVLFLAYWLPQMLSAFDAVDAGRALRKSATDLRYLPFMW
LCAIAVANAQRRRRTFTGLAVIGGVWTLDALLQAAFGTSPLFFGIDQIKQ
LISGHGLCTAQELALVDRLSGVLGPCNLKFGQTLASLSPFLLLALGRRHV
LAWLVGAAAVGIVLVLAGSRASWITYGVIMLLSGWQLLGGRRLLAVAVAG
ALLAVALVAVAPQARERIQRTTLAFGNGEQGVDQALSGRAQIWGAALCMI
REHPLNGVGARGFRQAYQACNPAPGRAPAWGDGPAFHAHQIVLEILAETG
VIGLLLWLAGAAQAWRAWRYSSVVAREQARPAMIALVATVFPFNTHLAFY
SSFWGGLSLMLAGLYAGALLNDDADRVSR
XFF4834R

NP_643773.1 XAC3466-XAC3466

1

404

S=1615 I=81 E=0

membrane protein

XFF4834R

YP_365325.1 waaL-XCV3594

1

404

S=1594 I=80 E=0

Lipid A core-O-antigen ligase

XFF4834R

NP_638685.1 XCC3339

1

404

S=1467 I=75 E=1.63216e-170

membrane protein

XFF4834R

XALc_0744 waaL-XALc_0744

1

404

S=1050 I=53 E=4.69601e-120

probable lipid a core-o-antigen ligase protein

Iprscan IPR007016 [PF04932]

207

358

O-antigen ligase-related

Iprscan [seg]

184

195

-

Iprscan [seg]

200

218

-

Iprscan [seg]

237

261

-

Iprscan [seg]

353

369

-

Iprscan [seg]

405

425

-

Iprscan [SignalP-NN(euk)]

1

26

-

Iprscan [tmhmm]

13

35

-

Iprscan [tmhmm]

48

70

-

Iprscan [tmhmm]

90

109

-

Iprscan [tmhmm]

116

138

-

Iprscan [tmhmm]

200

217

-

Iprscan [tmhmm]

222

239

-

Iprscan [tmhmm]

243

262

-

Iprscan [tmhmm]

341

363

-

Iprscan [tmhmm]

397

419

-

PD690841

62

275

S=675 I=67 E=2.89081e-74

PDA1L3V0

1

61

S=279 I=89 E=2.35324e-26

PD416824

288

352

S=155 I=48 E=2.4702e-11

PDA2F0B6

262

286

S=128 I=100 E=5.49544e-08

PDA3F4S1

262

286

S=114 I=88 E=2.75514e-06

PD323518

383

404

S=114 I=100 E=2.85292e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VDSBGgdG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr11810.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr11810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr11810.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr11810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
gtrB XFF4834R_chr15940
XFF4834R_chr15930
XFF4834R_chr15930
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15950
XFF4834R_chr15950
ID gtrB
AC XFF4834R_chr15940
LT XFF4834R_chr15940
OR XFF4834R_chr from 1840068 to 1841114 on strand +
DE putative bactoprenol glucosyl transferase
IP Glycosyl transferase, family 2
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro


Curated
PM
AN 38 % identity E. Coli : Putative Bactoprenol glucosyl transferase homolog from prophage CPS-53 CL : modification of O antigen
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100429)
MW 38113.6 Da
SQ 348 aa
 
........10........20........30........40........50
| | | | |
MSAIDTAQLPVAPERLTVLIAAFNEETSIPLLHPRLCAVLAQLPALQTHV
LYVDDGSTDGTWEVVHALTEADAQVSAVRLSRNFGKEVAISAGLDHVLPG
AVVLLDADGQDPPELIPEFVALWRGGYDNIFGTRVIREGESWLKRSAAHA
FYRVIRRLSRTPIPADTGDFRLLSPRVVQALQQLRERHRFMKGLFGWVGF
RQVALPYRREPRLSGHSKFTVWRLWNFALDGITSFSTVPLRAATYLGLLT
ALLAFLFGAWVVIKAALVGDPVAGWPTLMSVILFLGGVQLIALGLIGEYL
GRLYDEAKQRPLYLVDTHRGAVGVGCDHQSKRGAGHADRTTAVGDQAG
XFF4834R

XFF4834R_chr34830 lcl|XFF4834R_chr37970548_4039504_f2_XFF4834R-XFF4834R_chr34830

16

311

S=232 I=26 E=1.39577e-21

XFF4834R

XFF4834R_chr37970 lcl|XFF4834R_chr41060322_4387044_f1_XFF4834R-XFF4834R_chr37970

15

220

S=160 I=26 E=7.59068e-13

XFF4834R

XFF4834R_chr19410 lcl|pgaC-XFF4834R_chr19410

10

114

S=96 I=30 E=3.98992e-05

predicted glycosyl transferase

XFF4834R

XFF4834R_chr34830 lcl|XFF4834R_chr37970548_4039504_f2_XFF4834R-XFF4834R_chr34830

16

311

S=232 I=26 E=1.39577e-21

XFF4834R

XFF4834R_chr37970 lcl|XFF4834R_chr41060322_4387044_f1_XFF4834R-XFF4834R_chr37970

15

220

S=160 I=26 E=7.59068e-13

XFF4834R

XFF4834R_chr19410 lcl|pgaC-XFF4834R_chr19410

10

114

S=96 I=30 E=3.98992e-05

predicted glycosyl transferase

XFF4834R

YP_364914.1 lcl|gtrB-XCV3183

1

348

S=1649 I=92 E=0

putative bactoprenol glucosyltransferase

XFF4834R

NP_643355.1 lcl|gtrB-XAC3046

9

348

S=1632 I=93 E=0

glucosyl transferase

XFF4834R

NP_638211.1 lcl|gtrB-XCC2863

10

348

S=1446 I=82 E=3.84704e-168

glucosyl transferase

XFF4834R

lcl|wcaA-XALc_2191

10

348

S=1134 I=66 E=3.10333e-130

putative glycosyltransferase protein

XFF4834R

YP_365444.1 lcl|wxcL-XCV3713

49

317

S=203 I=25 E=1.70305e-17

glycosyltransferase

XFF4834R

lcl|XALc_2701

16

317

S=192 I=25 E=3.44804e-16

probable glycosyl transferase protein

XFF4834R

NP_636008.1 lcl|wxcL-XCC0616

49

317

S=185 I=25 E=2.97057e-15

glycosyltransferase

XFF4834R

NP_644210.1 lcl|dpm1-XAC3909

15

220

S=159 I=26 E=3.65281e-12

dolichol-phosphate mannosyltransferase

XFF4834R

lcl|XALc_0107

16

220

S=157 I=27 E=6.72486e-12

putative glycosyl transferase protein

XFF4834R

YP_365753.1 lcl|XCV4022

15

220

S=157 I=27 E=7.0245e-12

putative glycosyltransferase

XFF4834R

NP_639194.1 lcl|dpm1-XCC3854

15

238

S=152 I=28 E=2.29922e-11

dolichol-phosphate mannosyltransferase

pubmed

16

315

S=806 I=51 E=5.42815e-89

Glycosyl transferase, family 2 Putative polymixin resistance glycosyltransferase transmembrane protein ; Plasmid

Pubmed 7766206,11544228

 

prodomImg

pubmed

13

326

S=770 I=51 E=1.37517e-84

Glycosyl transferase, family 2 Putative polymixin resistance glycosyltransferase ; Plasmid

Pubmed 7766206,11544228

 

prodomImg

pubmed

15

320

S=642 I=40 E=4.29275e-69

GtrB

Pubmed 15963704

 

prodomImg

pubmed

15

320

S=638 I=40 E=1.31041e-68

Bactoprenol glucosyl transferase EC=2.4.1.- ; Glycosyltransferase Membrane Transmembrane

Pubmed 9426131

 

prodomImg

pubmed

15

319

S=635 I=39 E=2.72568e-68

Bactoprenol glucosyl transferase EC=2.4.1.- ; Glycosyltransferase Membrane Transmembrane

Pubmed 10376843

 

prodomImg

pubmed

15

319

S=634 I=39 E=4.07056e-68

Bactoprenol glucosyl transferase EC=2.4.1.- ; Glycosyltransferase Membrane Transmembrane

Pubmed 9305766,11889106

 

prodomImg

pubmed

15

315

S=630 I=39 E=1.07141e-67

GtrB

Pubmed 15071057

 

prodomImg

pubmed

15

315

S=630 I=39 E=1.07141e-67

O-antigen conversion protein

Pubmed 18621868

 

prodomImg

pubmed

15

315

S=630 I=39 E=1.24259e-67

GtrB

Pubmed 12754248

 

prodomImg

pubmed

15

315

S=629 I=39 E=1.54522e-67

GtrB

Pubmed 12562822

 

prodomImg

sp_Pdown

sp|Q55487|Y501_SYNY3

15

315

S=752 I=48 E=1.19603e-82

Uncharacterized glycosyltransferase sll0501 EC=2.4.-.- ; Cell membrane Transmembrane

sp_Pdown

sp|P68667|GTRB_SHIFL

15

320

S=638 I=40 E=9.0216e-69

SfII prophage-derived bactoprenol glucosyl transferase EC=2.4.1.- ; Cell membrane Glycosyltransferase Transmembrane

sp_Pdown

sp|P68668|GTRB_BPSF2

15

320

S=638 I=40 E=9.0216e-69

Bactoprenol glucosyl transferase EC=2.4.1.- ; Glycosyltransferase Membrane Transmembrane

sp_Pdown

sp|Q9T1D6|GTRB_BPSFX

15

319

S=635 I=39 E=1.87651e-68

Bactoprenol glucosyl transferase EC=2.4.1.- ; Glycosyltransferase Membrane Transmembrane

sp_Pdown

sp|O22007|GTRB_BPSF5

15

319

S=634 I=39 E=2.80239e-68

Bactoprenol glucosyl transferase EC=2.4.1.- ; Glycosyltransferase Membrane Transmembrane

PD360542

176

239

S=235 I=67 E=6.02559e-21

PD005262

260

315

S=195 I=58 E=3.37502e-16

PDA346I2

319

348

S=150 I=97 E=1.20031e-10

PDA1F9A6

137

172

S=141 I=69 E=1.47845e-09

PDA8A346

109

172

S=132 I=39 E=1.45168e-08

PD395383

15

83

S=114 I=38 E=2.12692e-06

PDA8A343

123

172

S=111 I=34 E=5.74663e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JPTCIMKV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

43 hits
swiss-prot

Swiss-Prot ncbi-blastp

73 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr15940.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr15940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr15940.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr15940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr25090466_2663434_r3_XFF4834R-XFF4834R_chr22970 XFF4834R_chr22970
XFF4834R_chr22960
XFF4834R_chr22960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr22980
XFF4834R_chr22980
ID XFF4834R_chr25090466_2663434_r3_XFF4834R-XFF4834R_chr22970
AC XFF4834R_chr22970
LT XFF4834R_chr22970
OR XFF4834R_chr from 2662466 to 2663434 on strand -
DE putative glycosyl transferase
IP Glycosyl transferase, family 4
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: phospho-N-acetylmuramoyl-pentapeptide-transferase activity (GO:0008963)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100521)
MW 34931.7 Da
SQ 322 aa
 
........10........20........30........40........50
| | | | |
MVWLWCVLHLLVAALGTWGLRRYALHRRLLDHPGERRSHVVATPRGGGMA
IVAAILLGCVAACVLWPTSRLTVCWFAAGLLAVAGVGWWDDHRPLSARLR
FSIHLAASAALGTLVWHDTGSVWDGVLAAAASVILINVWNFMDGINGLAS
TQAALAAVGFSLVAPAGWLWAGLAVAAACLGFVPFNFPRARIFMGDGGSG
ALGYVLAALLALNVSGGQVSWWISWLPLTAFLVDAGFTLLARMLSGQRWW
EPHAQHVYQRLARRLETHVPVTGVYFAFSLIAVCLYLLIRHDPFWLQVSG
ALVWGMGATAIWHFLRDGLRNS
Show or not Domain decomposition
 
XFF4834R

NP_642611.1 lcl|rfb303-XAC2294

1

322

S=1320 I=83 E=7.52781e-153

lipopolysaccharide core biosynthesis protein

XFF4834R

YP_364223.1 lcl|XCV2492

1

322

S=1247 I=81 E=4.70674e-144

glycosyltransferase

XFF4834R

NP_637546.1 lcl|rfb303-XCC2190

2

322

S=950 I=64 E=5.25107e-108

lipopolysaccharide core biosynthesis protein

XFF4834R

lcl|XALc_1598

12

320

S=581 I=43 E=2.72324e-63

putative glycosyl transferase protein

Iprscan IPR000715 [PTHR22926]

21

319

Glycosyl transferase, family 4

Iprscan IPR018481 [PF00953]

75

210

Glycosyl transferase, family 4, conserved region

Iprscan [seg]

77

87

-

Iprscan [seg]

163

178

-

Iprscan [seg]

197

217

-

Iprscan [SignalP-NN(euk)]

1

19

-

Iprscan [tmhmm]

2

24

-

Iprscan [tmhmm]

44

66

-

Iprscan [tmhmm]

71

89

-

Iprscan [tmhmm]

120

142

-

Iprscan [tmhmm]

155

177

-

Iprscan [tmhmm]

192

214

-

Iprscan [tmhmm]

221

243

-

Iprscan [tmhmm]

267

289

-

Iprscan [tmhmm]

294

316

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5mkbF3qR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

15 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr22970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr22970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr22970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr22970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr30730560_3250498_r3_XFF4834R-XFF4834R_chr28180 XFF4834R_chr28180
XFF4834R_chr28170
XFF4834R_chr28170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28190
XFF4834R_chr28190
ID XFF4834R_chr30730560_3250498_r3_XFF4834R-XFF4834R_chr28180
AC XFF4834R_chr28180
LT XFF4834R_chr28180
OR XFF4834R_chr from 3249560 to 3250498 on strand -
DE putative glycosyltransferase
IP Glycosyl transferase, family 2
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro


Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100622)
MW 35045.7 Da
SQ 312 aa
 
........10........20........30........40........50
| | | | |
MNDQAHARWPLVSVLIPAFNHARFVQRCLDSVLEDPYPCKEIVIIDDGSS
DATGEKIGQWISDHGHRLSVHFVQRENRGLAATLNELALRARGEYLRLGA
SDDYLLPGGLDAQVRYLRGHPQKLAVIGDACVVDTHGQLLHGSAMRDLHR
VDKDLYRSESGIRRAVIRQWAVSGAVALLRRSALRACSGWDESLRIEDWD
FFLRLVAGNALGFIDLPVCAYRLHGNNLSKTANVPARIANLRESRHVALR
CAPLFDEPDRTLLHAQAHYIAAKVEFLRRRPHRVAAHLVVYAWLSLPGRW
RPKRVARGAEPA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr19410 lcl|pgaC-XFF4834R_chr19410

10

205

S=137 I=27 E=4.18856e-10

predicted glycosyl transferase

XFF4834R

XFF4834R_chr15220 lcl|XFF4834R_chr16320014_1748098_r3_XFF4834R-XFF4834R_chr15220

6

121

S=134 I=32 E=1.01042e-09

XFF4834R

XFF4834R_chr20860 lcl|XFF4834R_chr22640642_2418166_r3_XFF4834R-XFF4834R_chr20860

11

140

S=103 I=26 E=4.71656e-06

XFF4834R

XFF4834R_chr20860 lcl|XFF4834R_chr22640642_2418166_r3_XFF4834R-XFF4834R_chr20860

3

52

S=97 I=41 E=2.69728e-05

XFF4834R

NP_642024.1 lcl|XAC1693-XAC1693

1

312

S=1404 I=87 E=4.96125e-163

glycosyl transferase

XFF4834R

YP_363457.1 lcl|XCV1726

1

291

S=928 I=65 E=1.95938e-105

glycosyltransferase

XFF4834R

NP_637043.1 lcl|XCC1673

7

291

S=876 I=62 E=4.1265e-99

glycosyl transferase

XFF4834R

NP_637293.1 lcl|rbfC-XCC1928

5

144

S=153 I=33 E=1.67474e-11

O-antigen biosynthesis protein

XFF4834R

NP_637293.1 lcl|rbfC-XCC1928

3

106

S=119 I=32 E=2.22563e-07

O-antigen biosynthesis protein

XFF4834R

lcl|XALc_1398

10

121

S=153 I=39 E=1.84332e-11

putative glycosyltransferase protein

XFF4834R

NP_643419.2 lcl|XAC3110-XAC3110

6

121

S=149 I=34 E=4.60451e-11

glycosyltransferase

XFF4834R

YP_364973.1 lcl|XCV3242

6

121

S=147 I=34 E=8.47693e-11

glycosyltransferase

XFF4834R

lcl|XALc_2250

10

122

S=146 I=37 E=1.10112e-10

putative glycosyl transferase protein

XFF4834R

NP_638281.2 lcl|XCC2933

6

169

S=143 I=31 E=3.02739e-10

glycosyl transferase

XFF4834R

NP_642137.1 lcl|hmsR-XAC1811

10

205

S=140 I=27 E=7.23967e-10

N-glycosyltransferase PgaC

Iprscan [G3DSA:3.90.550.10]

10

231

-

Iprscan [PTHR22916]

18

229

-

Iprscan IPR001173 [PF00535]

13

125

Glycosyl transferase, family 2

Iprscan [seg]

177

186

-

Iprscan [SSF53448]

10

231

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nhXY5kKe)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

227 hits
swiss-prot

Swiss-Prot ncbi-blastp

43 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr28180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr28180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr28180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr28180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rmlD XFF4834R_chr34760
XFF4834R_chr34750
XFF4834R_chr34750
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34770
XFF4834R_chr34770
ID rmlD
AC XFF4834R_chr34760
LT XFF4834R_chr34760
OR XFF4834R_chr from 4032314 to 4033213 on strand -
DE dTDP-4-dehydrorhamnose reductase
IP dTDP-4-dehydrorhamnose reductase
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
Biological Process: extracellular polysaccharide biosynthetic process (GO:0045226)
Biological Process: metabolic process (GO:0008152)
Molecular Function: dTDP-4-dehydrorhamnose reductase activity (GO:0008831)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)

Curated
PM
AN syn rfbD (old name)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 32015.8 Da
SQ 299 aa
 
........10........20........30........40........50
| | | | |
MTTLVIGASGQVGTELLRVLAPLGTVVAASRSGQLADGLSCERIDLNELA
SLDLALNRVRPALVVNAAAYTAVDRAEQERDAAFRANAEAPGVIAQWCAR
ADVPLVHYSTDYVFDGQGTRPYLPDDATAPLGVYGQSKLAGERAVQAAGG
RHLIFRTAWVYAAHGHNFLRTMLRVGAERDVLRVVADQIGTPTPAALIAD
ITAHALRQPGEPSGLWHLTAAGQTTWHGFAEAIFAQARARGLLARTPRVE
AIGTADYPTPAKRPAYSRLDTHSLQDTFGVRLPDWQDGLSQVLDTLAQR
XFF4834R

XFF4834R_chr37960 lcl|XFF4834R_chr41040994_4385959_f2_XFF4834R-XFF4834R_chr37960

1

142

S=93 I=27 E=7.85814e-05

XFF4834R

NP_643889.1 lcl|rmlD-XAC3582

1

299

S=1370 I=89 E=6.22568e-159

dTDP-4-keto-L-rhamnose reductase

XFF4834R

YP_365437.1 lcl|rmlD-XCV3706

27

299

S=1260 I=89 E=1.33805e-145

dTDP-4-dehydrorhamnose reductase

XFF4834R

lcl|rmlD-XALc_2694

1

299

S=1071 I=71 E=1.10255e-122

probable dtdp-4-dehydrorhamnose reductase protein

XFF4834R

NP_636016.1 lcl|rmlD-XCC0624

1

297

S=1030 I=69 E=8.90656e-118

dTDP-4-dehydrorhamnose reductase

pubmed

1

299

S=1067 I=72 E=1.34188e-120

DTDP-4-dehydrorhamnose reductase

Pubmed 16585771

 

prodomImg

pubmed

1

297

S=1020 I=68 E=5.68148e-115

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Oxidoreductase

Pubmed 8253667,1370280

 

prodomImg

pubmed

1

293

S=684 I=49 E=3.45865e-74

dTDP-4-dehydrorhamnose reductase

Pubmed 17453174

 

prodomImg

pubmed

1

296

S=679 I=47 E=1.09326e-73

RmlD

Pubmed 17449692

 

prodomImg

pubmed

1

296

S=679 I=47 E=1.17224e-73

RmlD

Pubmed 16055280

 

prodomImg

sp_Pdown

sp|P37778|RFBD_SHIFL

1

296

S=674 I=46 E=3.33426e-73

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Lipopolysaccharide biosynthesis NADP Oxidoreductase

sp_Pdown

sp|P37760|RFBD_ECOLI

1

296

S=664 I=46 E=5.15184e-72

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Lipopolysaccharide biosynthesis NADP Oxidoreductase

sp_Pdown

sp|P26392|RFBD_SALTY

1

296

S=639 I=45 E=5.51019e-69

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Lipopolysaccharide biosynthesis NADP Oxidoreductase

sp_Pdown

sp|Q46769|RFBD_ECOLX

1

296

S=632 I=45 E=4.62459e-68

dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; Lipopolysaccharide biosynthesis NADP Oxidoreductase

sp_Pdown

sp|P55463|RFBD_RHISN

61

293

S=487 I=43 E=1.41629e-50

Probable dTDP-4-dehydrorhamnose reductase EC=1.1.1.133 ; NADP Oxidoreductase Plasmid

Iprscan IPR016040 [G3DSA:3.40.50.720]

1

223

NAD(P)-binding domain

Iprscan [PTHR10491]

1

298

-

Iprscan IPR005913 [PF04321]

1

297

dTDP-4-dehydrorhamnose reductase

Iprscan IPR005913 [TIGR01214]

2

296

dTDP-4-dehydrorhamnose reductase

PD158607

198

299

S=210 I=42 E=5.0172e-18

PD576929

111

165

S=163 I=63 E=2.52893e-12

PDA1W924

1

110

S=159 I=45 E=7.32641e-12

PDA9G8K9

4

219

S=135 I=27 E=7.24464e-09

PDA1E0R3

1

48

S=126 I=52 E=7.82947e-08

PDA296X9

50

110

S=120 I=52 E=4.75926e-07

PDA9J045

4

156

S=118 I=30 E=8.46152e-07

PDA6R6O3

53

110

S=106 I=40 E=2.40695e-05

PDA1Q157

32

110

S=102 I=33 E=6.85247e-05

Iprscan IPR016040 [SSF51735]

1

299

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jHESyc0j)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

142 hits
swiss-prot

Swiss-Prot ncbi-blastp

15 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34760.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34760.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rmlC XFF4834R_chr34770
XFF4834R_chr34760
XFF4834R_chr34760
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34780
XFF4834R_chr34780
ID rmlC
AC XFF4834R_chr34770
LT XFF4834R_chr34770
OR XFF4834R_chr from 4033210 to 4033767 on strand -
DE dTDP-4-dehydrorhamnose 3,5-epimerase
IP dTDP-4-dehydrorhamnose 3,5-epimerase related
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
5-epimerase activity (GO:0008830)
Biological Process: lipopolysaccharide biosynthetic process (GO:0009103)

Curated
PM
AN syn rfbC (old name)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 20843.2 Da
SQ 185 aa
 
........10........20........30........40........50
| | | | |
MKVIDTSLPGCFVIEPRVLGDERGQFFEAWNAERFDQHGFSARFLQSNIS
TSTKGVLRGLHYQWPRPQGKLVSVLEGEVYDVAVDIRRGSPYFGQWTAAI
LSAENNRQFWIPEGFAHGFAVLSERAVFSYLCTDIYVHDADASVRWDDAT
IGVDWPISSPILSAKDRAAPFLEDIAEERLPVYQG
Show or not Domain decomposition
 
XFF4834R

NP_643890.1 lcl|rmlC-XAC3583

1

183

S=809 I=79 E=3.12074e-91

dTDP-4-dehydrorhamnose 3,5-epimerase

XFF4834R

NP_636015.1 lcl|rmlC-XCC0623

1

184

S=789 I=77 E=7.00935e-89

dTDP-4-dehydrorhamnose 3,5-epimerase

XFF4834R

lcl|rmlC-XALc_2695

1

184

S=787 I=79 E=1.21402e-88

probable dtdp-4-dehydrorhamnose 3,5-epimerase protein

XFF4834R

YP_365438.1 lcl|rmlC-XCV3707

1

183

S=773 I=76 E=6.35771e-87

dTDP-4-dehydrorhamnose 3,5-epimerase

XFF4834R

NP_637378.1 lcl|rfbD-XCC2013

6

170

S=321 I=40 E=3.72657e-32

strX protein

pubmed

1

184

S=789 I=77 E=2.66111e-87

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase

Pubmed 8253667,11589581

 

prodomImg

pubmed

1

183

S=749 I=73 E=1.98745e-82

DTDP-dehydrorhamnose 3,5-epimerase

Pubmed 16585771

 

prodomImg

pubmed

18

163

S=614 I=75 E=4.60861e-66

RfbD

Pubmed 18424531

 

prodomImg

pubmed

18

163

S=612 I=75 E=7.70857e-66

RfbD

Pubmed 18424531

 

prodomImg

pubmed

18

163

S=610 I=75 E=1.31205e-65

RfbD

Pubmed 18424531

 

prodomImg

sp_Pdown

sp|P26394|RFBC_SALTY

1

173

S=480 I=55 E=5.17157e-50

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Lipopolysaccharide biosynthesis

sp_Pdown

sp|P37780|RFBC_SHIFL

1

166

S=470 I=53 E=9.68028e-49

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Lipopolysaccharide biosynthesis

sp_Pdown

sp|P37763|RFBC_NEIGO

1

169

S=437 I=51 E=7.36302e-45

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Lipopolysaccharide biosynthesis

sp_Pdown

sp|P37745|RFBC_ECOLI

1

180

S=403 I=46 E=1.18539e-40

dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Lipopolysaccharide biosynthesis

sp_Pdown

sp|P55468|RFBC_RHISN

13

175

S=348 I=43 E=5.19269e-34

Probable dTDP-4-dehydrorhamnose 3,5-epimerase EC=5.1.3.13 ; Isomerase Plasmid

Iprscan IPR014710 [G3DSA:2.60.120.10]

1

175

RmlC-like jelly roll fold

Iprscan IPR000888 [PTHR21047]

1

184

dTDP-4-dehydrorhamnose 3,5-epimerase related

Iprscan IPR000888 [PF00908]

4

174

dTDP-4-dehydrorhamnose 3,5-epimerase related

Iprscan IPR000888 [TIGR01221]

2

176

dTDP-4-dehydrorhamnose 3,5-epimerase related

PD001462

1

174

S=509 I=56 E=3.36029e-54

Iprscan IPR011051 [SSF51182]

1

175

Cupin, RmlC-type

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one i3fvg6VQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

184 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34770.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34770.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rmlA XFF4834R_chr34780
XFF4834R_chr34770
XFF4834R_chr34770
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34790
XFF4834R_chr34790
ID rmlA
AC XFF4834R_chr34780
LT XFF4834R_chr34780
OR XFF4834R_chr from 4033764 to 4034651 on strand -
DE glucose-1-phosphate thymidylyltransferase
IP Glucose-1-phosphate thymidylyltransferase, long form
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
Biological Process: extracellular polysaccharide biosynthetic process (GO:0045226)
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: glucose-1-phosphate thymidylyltransferase activity (GO:0008879)
Molecular Function: nucleotidyltransferase activity (GO:0016779)

Curated
PM
AN syn rfbA (old name)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 32971.3 Da
SQ 295 aa
 
........10........20........30........40........50
| | | | |
MTQRKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPLSVLMLAGIR
EVLIINTPHEQSLFQTLLGDGEQWGMHIRYAVQPSPDGLAQAYLIGRDFI
DGKPSCLVLGDNIFHGHGLTDTLRRADARQQGATVFGYWVNDPERYGVAE
FDAQGKVIDIEEKPLQPRSNYAVTGLYFYDARACEYAAQLKPSSRGELEI
TDLNRRYLEAGDLHLEPLGRGYAWLDTGTHQSLHEASNFIETIQMRQGLQ
VCCPEEIAFAKGWIDAFQLEQLAAPLRKNAYGQYLHSLAQRGVVP
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr22950 lcl|galU-XFF4834R_chr22950

4

237

S=141 I=26 E=1.34408e-10

glucose-1-phosphate uridylyltransferase

XFF4834R

XFF4834R_chr16850 lcl|XFF4834R_chr18040300_1936010_r2_XFF4834R-XFF4834R_chr16850

5

111

S=115 I=31 E=1.91684e-07

XFF4834R

lcl|rmlA-XALc_2696

1

295

S=1418 I=89 E=8.78514e-165

probable glucose-1-phosphate thymidylyltransferase protein

XFF4834R

NP_643891.1 lcl|rmlA-XAC3584

1

295

S=1411 I=88 E=6.75758e-164

glucose-1-phosphate thymidylyltransferase

XFF4834R

YP_365439.1 lcl|rmlA-XCV3708

1

294

S=1403 I=88 E=5.77127e-163

glucose-1-phosphate thymidylyltransferase

XFF4834R

NP_636014.1 lcl|rmlA-XCC0622

1

294

S=1389 I=88 E=2.79426e-161

glucose-1-phosphate thymidylyltransferase

XFF4834R

NP_637544.1 lcl|galU-XCC2188

4

237

S=156 I=27 E=6.9634e-12

UTP-glucose-1-phosphate uridylyltransferase

XFF4834R

NP_642609.1 lcl|galU-XAC2292

4

237

S=144 I=26 E=2.21852e-10

UTP-glucose-1-phosphate uridylyltransferase

XFF4834R

YP_364221.1 lcl|galU-XCV2490

4

237

S=142 I=26 E=3.25589e-10

UTP-glucose-1-phosphate uridylyltransferase

XFF4834R

lcl|XALc_2122

5

111

S=132 I=37 E=5.83449e-09

putative nucleotidyl transferase protein

XFF4834R

lcl|galU-XALc_1596

4

237

S=129 I=26 E=1.33574e-08

probable utp-glucose-1-phosphate uridylyltransferase protein

XFF4834R

NP_638133.1 lcl|glgC-XCC2785

5

111

S=126 I=34 E=3.39529e-08

nucleotidyl transferase

XFF4834R

YP_364831.1 lcl|XCV3100

5

111

S=120 I=32 E=1.4948e-07

putative nucleotidyltransferase

XFF4834R

NP_643264.1 lcl|XAC2955-XAC2955

5

111

S=120 I=32 E=1.56141e-07

nucleotidyl transferase

pubmed

1

294

S=1389 I=88 E=1.14153e-159

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

Pubmed 8253667

 

prodomImg

pubmed

1

294

S=1357 I=86 E=9.39144e-156

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Magnesium Metal-binding Nucleotidyltransferase

Pubmed 16585771

 

prodomImg

pubmed

4

288

S=1077 I=70 E=8.36635e-122

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Magnesium Metal-binding Nucleotidyltransferase

Pubmed 9988483

 

prodomImg

pubmed

5

295

S=1071 I=67 E=3.91514e-121

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Magnesium Metal-binding Nucleotidyltransferase

Pubmed 15073305

 

prodomImg

pubmed

1

290

S=1068 I=68 E=8.00278e-121

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Magnesium Metal-binding Nucleotidyltransferase

Pubmed 19040662

 

prodomImg

sp_Pdown

sp|P0C7J4|RMLA_XANCP

1

294

S=1389 I=88 E=7.77261e-160

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

sp_Pdown

sp|B0RVK9|RMLA_XANCB

1

294

S=1389 I=88 E=7.77261e-160

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

sp_Pdown

sp|P55254|RMLA_SALAN

1

290

S=1065 I=68 E=1.39722e-120

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

sp_Pdown

sp|P37744|RMLA1_ECOLI

1

290

S=1063 I=68 E=2.33705e-120

Glucose-1-phosphate thymidylyltransferase 1 EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

sp_Pdown

sp|P55253|RMLA3_ECOLX

1

290

S=1057 I=68 E=1.20373e-119

Glucose-1-phosphate thymidylyltransferase EC=2.7.7.24 ; Lipopolysaccharide biosynthesis Magnesium Metal-binding Nucleotidyltransferase

Iprscan [G3DSA:3.90.550.10]

5

294

-

Iprscan [PTHR22572:SF13]

12

289

-

Iprscan [PTHR22572]

12

289

-

Iprscan IPR005835 [PF00483]

5

241

Nucleotidyl transferase

Iprscan IPR005907 [TIGR01207]

5

290

Glucose-1-phosphate thymidylyltransferase, long form

PD001252

7

293

S=475 I=40 E=4.64042e-50

PDA95123

5

80

S=120 I=38 E=5.56705e-07

PDA036R5

1

114

S=102 I=25 E=6.67446e-05

Iprscan [SSF53448]

4

294

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0h7KyT9l)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

293 hits
swiss-prot

Swiss-Prot ncbi-blastp

165 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34780.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34780.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmELw4D/XFF4834R_chr34780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
rmlB XFF4834R_chr34790
XFF4834R_chr34780
XFF4834R_chr34780
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3697
XFF4834R_chr_3697
ID rmlB
AC XFF4834R_chr34790
LT XFF4834R_chr34790
OR XFF4834R_chr from 4034703 to 4035758 on strand -
DE dTDP-glucose 4,6-dehydratase
IP NAD-dependent epimerase/dehydratase
CL 1.6.3.1 antigen GO:0009243
EC
GO InterPro
6-dehydratase activity (GO:0008460)
Biological Process: metabolic process (GO:0008152)
Biological Process: cellular metabolic process (GO:0044237)
Biological Process: nucleotide-sugar metabolic process (GO:0009225)
Molecular Function: coenzyme binding (GO:0050662)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN start change : alternative codon Val located 6 aa before the initial start which is also a Val (but it is coded as a M on the initial sequence and multialign) syn rfbB (old name)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110127)
MW 38477 Da
SQ 351 aa
 
........10........20........30........40........50
| | | | |
VATWLVTGGAGFIGGNFVLEAVARGVRVINLDALTYAGNLKTLASLEDNP
NHVFVKGNIGDGALVDRLLAEHQPDAVLNFAAESHVDRSIDGPGAFIQTN
VVGTLALLESVRDYWKALPQESRHAFRFLHVSTDEVYGTLGETGKFTETT
PYAPNSPYSASKAASDHLVRAFHHTYGLPVLTTNCSNNYGPYHFPEKLIP
LVIAKALAGEPLPVYGDGKQVRDWLFVSDHCDAIRTVLAKGRVGETYNVG
GNAERQNIEVVRTICALLDQQRPRSDGQLRASQITHVTDRPGHDRRYAID
ASKLRNELGWQPAYTFEQGIALTVQWYLDNQAWVQGVLDGSYRLERIGVA
A
XFF4834R

XFF4834R_chr37960 lcl|XFF4834R_chr41040994_4385959_f2_XFF4834R-XFF4834R_chr37960

3

326

S=232 I=29 E=1.25965e-21

XFF4834R

XFF4834R_chr34900 lcl|gmd-XFF4834R_chr34900

5

325

S=162 I=24 E=4.42989e-13

GDP-D-mannose dehydratase, NAD(P)-binding

XFF4834R

XFF4834R_chr36310 lcl|galE-XFF4834R_chr36310

5

250

S=142 I=30 E=1.07619e-10

UDP-galactose-4-epimerase

XFF4834R

YP_365440.1 lcl|rmlB-XCV3709

1

351

S=1709 I=91 E=0

dTDP-glucose 4,6-dehydratase

XFF4834R

NP_643892.1 lcl|rmlB-XAC3585

1

351

S=1696 I=90 E=0

dTDP-glucose 4,6-dehydratase

XFF4834R

NP_636013.1 lcl|rmlB-XCC0621

1

348

S=1676 I=89 E=0

dTDP-glucose 4,6-dehydratase

XFF4834R

lcl|rmlB-XALc_2697

1

351

S=1657 I=88 E=0

probable dtdp-glucose 4,6-dehydratase protein

XFF4834R

lcl|rmd-XALc_2707

5

331

S=248 I=29 E=5.38248e-23

probable ndp-hexose oxidoreductase protein

XFF4834R

YP_365752.1 lcl|wbnF-XCV4021

3

326

S=242 I=28 E=3.66449e-22

nucleotide sugar epimerase

XFF4834R

NP_639193.1 lcl|wbnF-XCC3853

3

326

S=235 I=29 E=2.45172e-21

nucleotide sugar epimerase

XFF4834R

NP_644209.1 lcl|wbnF-XAC3908

3

326

S=233 I=29 E=4.39711e-21

nucleotide sugar epimerase

XFF4834R

lcl|gla-XALc_0106

3

329

S=229 I=26 E=1.38991e-20

putative nucleoside-diphosphate-sugar epimerases protein

XFF4834R

lcl|gmd-XALc_2706

5

324

S=169 I=24 E=2.4354e-13

probable gdp-mannose 4,6-dehydratase protein

XFF4834R

YP_365449.1 lcl|gmd-XCV3718

5

325

S=149 I=24 E=6.34396e-11

GDP-mannose 4,6-dehydratase

XFF4834R

NP_644047.1 lcl|XAC3740-XAC3740

5

250

S=143 I=30 E=2.94297e-10

UDP-glucose 4-epimerase

XFF4834R

NP_635998.1 lcl|XCC0606

1

238

S=142 I=25 E=3.78961e-10

GDP-mannose 4,6 dehydratase

XFF4834R

YP_365590.1 lcl|galE-XCV3859

5

250

S=141 I=30 E=6.45016e-10

UDP-glucose 4-epimerase

XFF4834R

NP_639042.1 lcl|XCC3696

5

338

S=133 I=27 E=5.4135e-09

UDP-glucose 4-epimerase