Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr14510XFF4834R_chr15440571_1662340_r3_XFF4834R-XFF4834R_chr14510XFF4834R_chr14510putative siderophore biosynthesis protein
  2. XFF4834R_chr14530XFF4834R_chr15460511_1665313_r3_XFF4834R-XFF4834R_chr14530XFF4834R_chr14530putative siderophore biosynthesis protein

XFF4834R_chr15440571_1662340_r3_XFF4834R-XFF4834R_chr14510 XFF4834R_chr14510
XFF4834R_chr14500
XFF4834R_chr14500
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14520
XFF4834R_chr14520
ID XFF4834R_chr15440571_1662340_r3_XFF4834R-XFF4834R_chr14510
AC XFF4834R_chr14510
LT XFF4834R_chr14510
OR XFF4834R_chr from 1660571 to 1662340 on strand -
DE putative siderophore biosynthesis protein
IP IucA/IucC
CL 1.6.18 Siderophore
EC
GO InterPro
Biological Process: siderophore biosynthetic process (GO:0019290)
Molecular Function: siderophore-iron transmembrane transporter activity (GO:0015343)

Curated
PM
AN
CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 64822.4 Da
SQ 589 aa
 
........10........20........30........40........50
| | | | |
MSPHTMHDPWYDSMADAQACSCWLNCYLREFAIPQHAVQFDYRGLDRPGP
RVAEQRWLRIDLGESGALCVRIAYADRLGRCRFASAPFLKSAGKPWHSLD
AQALARCLLQALGSAQAINPELLAQSANSVAVTAALLRQAQVTPATGEAM
IDAEQSMLWGHALHPTPKSREGVDLDQVLACAPEARAAFQLFWFRIDPRL
LRTQGRDVRATLRQLCGSDDLYPCHPWEAQRLLDAPLLRSLQARGLIAPV
GPLGDALRPTSSVRTLYHPELAYFLKCSVHVRLTNCVRKNAWYELESAVA
LTELLAPSWRALATQVPGFDVMLEPAATSLDVASVDPALHAADPLAARGL
SESFGILYRQSIPAAQRARWQPQVAAALFTCDAQGNSVCAARLRALGSAQ
MDRPTATLLWFRAYAGLLLDGVWSALFQHGIALEPHLQNTVIGFAGGWPT
RVWVRDLEGTKLLAHHWPAARLRGVGERARQSLYYTPEQGWNRVAYCALV
NNLAEAIFHLGEGDAALEARLWQCVGEIALRWQQRHGAQAALQGLLDGAP
LPGKNNLGTRLWQRADRQSDYTALPNPIPRVTATRQVAA
XFF4834R

NP_643488.1 lcl|iucA-XAC3180

1

589

S=2756 I=91 E=0

iron transporter

XFF4834R

YP_365041.1 lcl|XCV3310

1

589

S=2716 I=89 E=0

putative siderophore biosynthesis protein

XFF4834R

NP_638401.1 lcl|iucA-XCC3054

1

589

S=2248 I=75 E=0

iron transporter

XFF4834R

lcl|XALc_0719

1

589

S=1843 I=63 E=0

putative siderophore biosynthesis protein.

pubmed

24

577

S=1104 I=42 E=7.45856e-125

Vibrioferrin biosynthesis protein PvsD

Pubmed 14617658

 

prodomImg

pubmed

24

577

S=1094 I=42 E=1.44566e-123

PvsD

Pubmed 17593352

 

prodomImg

pubmed

24

577

S=498 I=31 E=2.57258e-51

AcsD protein ; Plasmid

Pubmed 15995217

 

prodomImg

pubmed

121

578

S=371 I=27 E=4.97152e-36

SbnE

Pubmed 14688077

 

prodomImg

pubmed

121

578

S=310 I=27 E=1.23462e-28

Rhizobactin siderophore biosynthesis protein rhbC ; Ion transport Iron Plasmid

Pubmed 11274118,11481432

 

prodomImg

pubmed

153

460

S=283 I=30 E=2.40994e-25

Aerobactin synthetase

Pubmed 15215626

 

prodomImg

pubmed

152

528

S=267 I=27 E=1.95166e-23

IucA Siderophore biosynthesis protein

Pubmed 10411725

 

prodomImg

pubmed

152

528

S=264 I=27 E=5.18196e-23

IucA protein

Pubmed 15292145

 

prodomImg

pubmed

152

528

S=262 I=27 E=8.74347e-23

IucA ; Plasmid

Pubmed 19202093

 

prodomImg

pubmed

152

528

S=262 I=27 E=9.54001e-23

IucA ; Plasmid

Pubmed 16885466

 

prodomImg

sp_Pdown

sp|Q9Z3R0|RHBC_RHIME

121

578

S=310 I=27 E=8.50242e-29

Rhizobactin siderophore biosynthesis protein rhbC ; Ion transport Iron Plasmid

sp_Pdown

sp|Q47316|IUCA_ECOLX

152

528

S=248 I=27 E=3.0988e-21

Aerobactin siderophore biosynthesis protein iucA ; Ion transport Iron Plasmid

Iprscan IPR007310 [PF04183]

148

381

IucA/IucC

Iprscan [PF06276]

409

567

-

Iprscan [seg]

99

112

-

Iprscan [seg]

336

347

-

Iprscan [seg]

537

553

-

PDA026F2

7

98

S=294 I=65 E=5.30178e-28

PD720452

348

409

S=240 I=79 E=1.71168e-21

PDA1J503

469

518

S=175 I=66 E=1.2641e-13

PD720455

224

404

S=164 I=30 E=2.49325e-12

PDA3B7Q6

119

150

S=144 I=97 E=6.96382e-10

PDA3B7Q5

1

23

S=131 I=100 E=2.42078e-08

PD845584

519

589

S=125 I=45 E=1.26879e-07

PD145319

147

202

S=121 I=42 E=4.04573e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one t2VhTUmj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzxjhP/XFF4834R_chr14510.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzxjhP/XFF4834R_chr14510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzxjhP/XFF4834R_chr14510.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzxjhP/XFF4834R_chr14510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr15460511_1665313_r3_XFF4834R-XFF4834R_chr14530 XFF4834R_chr14530
XFF4834R_chr14520
XFF4834R_chr14520
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14540
XFF4834R_chr14540
ID XFF4834R_chr15460511_1665313_r3_XFF4834R-XFF4834R_chr14530
AC XFF4834R_chr14530
LT XFF4834R_chr14530
OR XFF4834R_chr from 1663511 to 1665313 on strand -
DE putative siderophore biosynthesis protein
IP IucA/IucC
CL 1.6.18 Siderophore
EC
GO InterPro
Biological Process: siderophore biosynthetic process (GO:0019290)
Molecular Function: siderophore-iron transmembrane transporter activity (GO:0015343)

Curated
PM
AN
CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 66145.9 Da
SQ 600 aa
 
........10........20........30........40........50
| | | | |
MSSMADQRYIATRIIDACLREDLRGIATRGSAAVPDAEVLAQWTDPMPVQ
GWWRIAHLPGGTVWLPIHRQGALQDIGACGDSWIVRNNDGVHVERGAHAW
LQRLGAQLDSETQQLHRAYADEADCAAAHRGLARQAYHAQAPALRTALHH
RDAAERAYRCDQLASYRDHPFYPTARAKAGLEAAELRHYAPEFAPTFALR
WLAIPQALAQCTSAPPAALWPQFENLGLPPELAATHLAWPVHPLVSERLE
QEGFALPEGVQRAPNAWLDVRPTLSVRTLVPLQHPHLHLKLPIPMRTLGA
LNLRLIKPSTLYDGHWMERALRHIDAVDPALQGRCVFVDESHGGHVGQTR
HLAYLVRRYPALDDATLVPVAALCAPMPDGRPMAIHLAERFAHGEVLRWW
RDYTELLLAVHLRLWLRYGVALEANQQNSVLVYADGQATRLLMKDNDAAR
IALPQLRQALPEVDALGPLQDARIAVDDPQALAQMFCTIVLQLDLQAVLE
GLAEWQPALRAPLYAQLQAQVAATLAQVEGDGIDIGPARRLLAAPRLPVK
YLLSAGSLLSKQLTGATDINKFYGDSAPNPFGDAFADARHPPRTQAGAAR
XFF4834R

NP_643486.2 lcl|XAC3178-XAC3178

1

600

S=2620 I=85 E=0

hypothetical protein

XFF4834R

YP_365039.1 lcl|XCV3308

1

600

S=2514 I=82 E=0

putative siderophore biosynthesis protein

XFF4834R

NP_638399.2 lcl|XCC3052

1

582

S=1977 I=70 E=0

hypothetical protein

XFF4834R

lcl|XALc_0721

1

585

S=1554 I=56 E=0

conserved hypothetical protein.

pubmed

9

579

S=902 I=39 E=2.71665e-100

Vibrioferrin biosynthesis protein PvsB

Pubmed 14617658

 

prodomImg

pubmed

9

451

S=772 I=39 E=1.45605e-84

PvsB

Pubmed 17593352

 

prodomImg

pubmed

148

504

S=220 I=29 E=1.01473e-17

AcsA protein ; Plasmid

Pubmed 15995217

 

prodomImg

pubmed

169

490

S=184 I=28 E=2.75643e-13

Legiobactin biosynthesis protein A

Pubmed 16452417

 

prodomImg

pubmed

141

504

S=178 I=24 E=1.38309e-12

SbnC

Pubmed 14688077

 

prodomImg

pubmed

169

457

S=149 I=22 E=4.67598e-09

FslA

Pubmed 16707671

 

prodomImg

pubmed

169

457

S=149 I=22 E=4.67598e-09

FslA

Pubmed 16707671

 

prodomImg

pubmed

169

457

S=141 I=21 E=4.71299e-08

FigA

Pubmed 16790797

 

prodomImg

Iprscan IPR007310 [PF04183]

157

376

IucA/IucC

Iprscan [PF06276]

398

558

-

Iprscan [seg]

118

128

-

Iprscan [seg]

279

292

-

Iprscan [seg]

406

416

-

Iprscan [seg]

511

527

-

Iprscan [seg]

537

548

-

PD608766

4

150

S=416 I=59 E=7.44268e-43

PD608762

469

579

S=297 I=60 E=2.36616e-28

PDA1V8G4

205

240

S=166 I=92 E=1.48369e-12

PD145319

151

216

S=139 I=36 E=2.87097e-09

PDA8R007

213

271

S=110 I=51 E=9.70625e-06

PD720453

220

270

S=105 I=43 E=3.4065e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3t1ztLsb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzxjhP/XFF4834R_chr14530.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzxjhP/XFF4834R_chr14530.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzxjhP/XFF4834R_chr14530.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRzxjhP/XFF4834R_chr14530.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.