Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr34900gmdXFF4834R_chr34900putative GDP-mannose 4,6-dehydratase

gmd XFF4834R_chr34900
XFF4834R_chr34890
XFF4834R_chr34890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34910
XFF4834R_chr34910
ID gmd
AC XFF4834R_chr34900
LT XFF4834R_chr34900
OR XFF4834R_chr from 4047140 to 4048180 on strand -
DE putative GDP-mannose 4,6-dehydratase
IP NAD-dependent epimerase/dehydratase
CL 1.6.17 GDP-mannose metabolism
EC
GO InterPro
6-dehydratase activity (GO:0008446)
Biological Process: metabolic process (GO:0008152)
Biological Process: cellular metabolic process (GO:0044237)
Biological Process: GDP-mannose metabolic process (GO:0019673)
Cellular Component: intracellular (GO:0005622)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: coenzyme binding (GO:0050662)

Curated
PM
AN probably involved in LPS biosynthesis
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100812)
MW 39058.4 Da
SQ 346 aa
 
........10........20........30........40........50
| | | | |
MTNKIAIITGITGQDGAYLTELLLGKGYKVYGTYRRTSSVNFWRLEEVGV
AKHPNLELVEYDLTDLGTTIAMVQKIQPDEIYNLAAQSFVGVSFDQPTTT
AQITGIGALHLLEAIRLVNPKIRFYQASTSEMFGKVQAVPQKEDTPFWPR
SPYGVAKLYAHWITVNYRESYDIFGSSGILFNHESPLRGREFVTRKITDS
VAKIKLGQLDVLQLGNLDAKRDWGFAKEYVEGMWRMLQADEADTFVLATN
RTETVRDFVRMAFKGAGIDVEFRGKDLDETAVDTATGKLVLQINPKFHRP
AEVDLLIGDPEKAERLLGWKPQTTLEQLCQMMVEADLKRNERGFSF
XFF4834R

XFF4834R_chr34790 lcl|rffG-XFF4834R_chr34790

8

334

S=160 I=25 E=8.22262e-13

dTDP-glucose 4,6-dehydratase

XFF4834R

XFF4834R_chr37960 lcl|XFF4834R_chr41040994_4385959_f2_XFF4834R-XFF4834R_chr37960

7

237

S=148 I=27 E=2.07022e-11

XFF4834R

XFF4834R_chr34890 lcl|XFF4834R_chr38050206_4046940_r1_XFF4834R-XFF4834R_chr34890

77

338

S=147 I=25 E=2.55207e-11

XFF4834R

YP_365449.1 lcl|gmd-XCV3718

1

346

S=1756 I=94 E=0

GDP-mannose 4,6-dehydratase

XFF4834R

NP_635998.1 lcl|XCC0606

4

316

S=1438 I=84 E=4.27338e-167

GDP-mannose 4,6 dehydratase

XFF4834R

lcl|gmd-XALc_2706

3

339

S=990 I=58 E=7.71972e-113

probable gdp-mannose 4,6-dehydratase protein

XFF4834R

lcl|rmd-XALc_2707

62

273

S=239 I=30 E=8.15447e-22

probable ndp-hexose oxidoreductase protein

XFF4834R

NP_643892.1 lcl|rmlB-XAC3585

5

334

S=170 I=25 E=1.65572e-13

dTDP-glucose 4,6-dehydratase

XFF4834R

YP_365440.1 lcl|rmlB-XCV3709

7

334

S=165 I=25 E=7.41766e-13

dTDP-glucose 4,6-dehydratase

XFF4834R

YP_365448.1 lcl|rmd-XCV3717

1

339

S=165 I=24 E=7.81602e-13

NDP-hexose oxidoreductase

XFF4834R

NP_636000.1 lcl|rmd-XCC0608

1

335

S=158 I=24 E=5.2751e-12

UDP-glucose 4-epimerase

XFF4834R

NP_636013.1 lcl|rmlB-XCC0621

7

237

S=158 I=27 E=5.46231e-12

dTDP-glucose 4,6-dehydratase

XFF4834R

lcl|rmlB-XALc_2697

7

334

S=154 I=24 E=1.68204e-11

probable dtdp-glucose 4,6-dehydratase protein

XFF4834R

lcl|gla-XALc_0106

7

295

S=151 I=25 E=3.34942e-11

putative nucleoside-diphosphate-sugar epimerases protein

XFF4834R

NP_639193.1 lcl|wbnF-XCC3853

7

305

S=150 I=25 E=4.83062e-11

nucleotide sugar epimerase

XFF4834R

YP_365752.1 lcl|wbnF-XCV4021

7

237

S=149 I=27 E=6.27477e-11

nucleotide sugar epimerase

XFF4834R

NP_644209.1 lcl|wbnF-XAC3908

7

237

S=142 I=26 E=4.01905e-10

nucleotide sugar epimerase

pubmed

4

346

S=1586 I=85 E=0

Putative GDP-mannose 4,6-dehydratase EC=4.2.1.47 ; Lyase

Pubmed 11589581

 

prodomImg

pubmed

4

346

S=1503 I=78 E=2.34275e-173

Gmd

Pubmed 19682076

 

prodomImg

pubmed

3

342

S=1039 I=58 E=3.30985e-117

GDP-mannose dehydratase ; Plasmid

Pubmed 15033235

 

prodomImg

pubmed

4

342

S=986 I=58 E=9.62438e-111

GDP-mannose 4,6-dehydratase EC=4.2.1.47 ; Lipopolysaccharide biosynthesis Lyase NAD

Pubmed 8548534

 

prodomImg

pubmed

4

339

S=984 I=54 E=1.71113e-110

Probable GDP-mannose 4,6-dehydratase EC=4.2.1.47 ; Lipopolysaccharide biosynthesis Lyase NAD

Pubmed 8932701

 

prodomImg

sp_Pdown

sp|Q51366|GM4D_PSEAE

4

342

S=986 I=58 E=6.60565e-111

GDP-mannose 4,6-dehydratase EC=4.2.1.47 ; Lipopolysaccharide biosynthesis Lyase NAD

sp_Pdown

sp|Q56872|GM4D_YERE8

4

339

S=984 I=54 E=1.17442e-110

Probable GDP-mannose 4,6-dehydratase EC=4.2.1.47 ; Lipopolysaccharide biosynthesis Lyase NAD

sp_Pdown

sp|O85713|NOEL_RHIFR

1

338

S=960 I=54 E=9.25766e-108

GDP-mannose 4,6-dehydratase EC=4.2.1.47 ; Lyase NAD Nodulation Plasmid

sp_Pdown

sp|P55354|NOEL_RHISN

1

338

S=954 I=54 E=5.53012e-107

GDP-mannose 4,6-dehydratase EC=4.2.1.47 ; Lyase NAD Nodulation Plasmid

sp_Pdown

sp|Q8K3X3|GMDS_CRIGR

4

338

S=948 I=53 E=2.94947e-106

GDP-mannose 4,6 dehydratase EC=4.2.1.47 ; Acetylation Lyase NADP

Iprscan IPR016040 [G3DSA:3.40.50.720]

4

268

NAD(P)-binding domain

Iprscan IPR006368 [PTHR10366:SF32]

8

343

GDP-mannose 4,6-dehydratase

Iprscan [PTHR10366]

8

343

-

Iprscan IPR001509 [PF01370]

7

245

NAD-dependent epimerase/dehydratase

Iprscan IPR006368 [TIGR01472]

4

340

GDP-mannose 4,6-dehydratase

PD578622

158

231

S=302 I=76 E=4.06671e-29

PDA9I073

6

316

S=189 I=24 E=1.74045e-15

PDA12634

62

152

S=180 I=44 E=2.27866e-14

PDA1H052

317

346

S=152 I=87 E=6.6425e-11

PDA1G9R0

39

69

S=147 I=77 E=2.37226e-10

PD334387

4

38

S=145 I=77 E=4.32943e-10

PDA2K309

79

171

S=125 I=32 E=1.07029e-07

PDA6E5D0

291

337

S=119 I=49 E=5.70835e-07

PDA1B482

233

270

S=118 I=55 E=7.54534e-07

PDA1F7W4

132

157

S=114 I=77 E=2.32347e-06

Iprscan IPR016040 [SSF51735]

3

342

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one v7G2TVx9)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

219 hits
swiss-prot

Swiss-Prot ncbi-blastp

53 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBb1ASfx/XFF4834R_chr34900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBb1ASfx/XFF4834R_chr34900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBb1ASfx/XFF4834R_chr34900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBb1ASfx/XFF4834R_chr34900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.