Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr34100bcsCXFF4834R_chr34100cellulose synthase subunit C
  2. XFF4834R_chr34120bcsBXFF4834R_chr34120Putative cellulose synthase subunit B
  3. XFF4834R_chr34130bcsAXFF4834R_chr34130probable cellulose synthase catalytic subunit [UDP-forming]

bcsC XFF4834R_chr34100
XFF4834R_chr_3620
XFF4834R_chr_3620
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34110
XFF4834R_chr34110
ID bcsC
AC XFF4834R_chr34100
LT XFF4834R_chr34100
OR XFF4834R_chr from 3937100 to 3941629 on strand -
DE cellulose synthase subunit C
IP Cellulose synthase operon C, C-terminal; Tetratricopeptide-like helical; Tetratricopeptide region
CL 1.6.16 Cellulose biosynthesis GO:0030244
EC
GO InterPro
Biological Process: cellulose biosynthetic process (GO:0030244)
Cellular Component: outer membrane (GO:0019867)
Molecular Function: binding (GO:0005488)

Curated
PM
AN
CC COG: [NSU] Cell motility;Function unknown;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: acur
CC STATUS: curated by poussier (20100510)
MW 159466.7 Da
SQ 1509 aa
 
........10........20........30........40........50
| | | | |
MRRNDLKPFYLAGMLELCLLAAPAAHAQTSATQQLVEQGNYWHDQGRDDL
AADTWKKLLGIDPDQPDALLGLAQIDLAQGRQSEARKRLQQLEDAHPQSP
QAQRLRVAIGARGGSGAGEDSNLRNARRAASAGRYVDAARSYEAAFAGKP
PPPNLALEYYQSLAGTPTGWERARDGLRRLQSSDPGNPSVQLALAQVLSY
REATRRDGIAQLRTLAQRADVGGPARGSWRQALLWLNAGMADAPLYQAFL
AGTPNDAEVTAKLGQLRAQRAVATTPADPNGVLLGEGFRALSANNLSAAE
QRFTQVLRARARDPEALGGLGSVRLRQQRFAEAQELLRPAAASNGKWKSA
LESARYWQQLQQAEAARARGDLAQARQLIEQAVQLLPNDPAGHVALGDLQ
AAGDPVAAEASYRKALSREADNAGALQGLVGLYSRQGRLQEASALFDRLP
AAERARSGGQALLRSNVQRARARQLLDAGDAVSAQTELEAAMVERPGDAW
IRLDLARLYQQAGRPDQARSVMDGLLAVHGDQAEALHANALLAQEGGDWQ
GAYDSLDRIPAAARTPAMTQLRATAWIQLQARQARQLVAQGRVGEAQQLL
ARTETALGNQLDDPQLLAALAGAHADAGNTQRALVLAQRLVTGASPRIED
RLQYASVLLRAHQDAELSAVLRQLQATTMTPEQLRRYQGLRSAYTLRQVD
ALRELGNLEGAYDALSPVLAQQPDNRDAQAALARLYAAAGEHRQALAIYQ
QILQRRPSDLDTLTAAADSAAAQSDLRNAERYLQRALAQAPESPDVLAAA
GRVYRSAGKNRKAEQYFRAALAAQQRQAGQLDNGLASAGGPAAAAASGRP
LNPFSGMTGAMPRSPAVLSERMDAGSAYNDVATAPVAYIAPLAMQPGAAR
VATAAPVNAAADSSSDALPQPVRASTVPSTLPAPSSRVRASTHGALPPVS
GSDPQPRGIAAQALPARSSGNSVLDELRAVQAENSDNLAGGALYRARDGE
DGLGRLDDIEMPVQAEFAVGEGKLGVTLTPTVVDAGTLGTDYATASRFGT
GPQSAIGDALAANRGPIDTLVDSPVYQLLATEGDTAATRERLRRYTLNTG
LFNALLVENNNSTAAALAALANEPLPAYLLSINASNTPIGQLARDILGNA
ALSEQLGAGDAAALRALAGSTAAAQQTPTGLADTLDVMAASGNGSRRLSQ
DDTGVGVGVRYRNGGFSAELGSTPIGFQEQNLIGGVGYRGELGDTVSWSA
EASRRAVTDSVLSFAGAQDARSGRQWGGVTSTGLSLSATADNGLLGGYAS
LAAHRLQGNNVADNDHRQVDLGFYVHALETEHQSLTAGVNLTTMQYDKNL
SGFTYGHGGYFSPQDYVDLGFPVHWSGRTAGQAVNWKVDASVGVQHFSTE
ASPYFPTDPTLQQAAYDAASLAALLGLVNRYTDPVYAGESRTGVSYNLSG
AAEWQVAPQLFLGGRLTFNNARDYNQFSSNLYLRFVMDRLGAALGRAPQV
LTSPYAAEH
XFF4834R

NP_643822.1 lcl|bcsC-XAC3515

1

1509

S=6148 I=82 E=0

cellulose synthase subunit C

XFF4834R

YP_365371.1 lcl|bcsC-XCV3640

1

1509

S=5985 I=80 E=0

putative cellulose synthase operon protein C

XFF4834R

NP_636075.1 lcl|bcsC-XCC0683

1367

1509

S=630 I=80 E=1.84399e-68

cellulose synthase subunit C

XFF4834R

NP_636074.1 lcl|XCC0682

568

655

S=229 I=59 E=6.55126e-20

cellulose synthase subunit C

pubmed

36

817

S=879 I=33 E=4.84653e-97

Cellulose synthase operon protein C ; biosynthesis Repeat Signal TPR

Pubmed 12019221

 

prodomImg

pubmed

1199

1506

S=476 I=34 E=3.36945e-48

Cellulose synthase operon protein C ; biosynthesis Repeat Signal TPR

Pubmed 12019221

 

prodomImg

pubmed

36

527

S=448 I=32 E=7.496e-45

Cellulose synthase operon protein C ; membrane outer biosynthesis Repeat Signal TPR

Pubmed 9630539

 

prodomImg

pubmed

1210

1407

S=265 I=33 E=1.08008e-22

Cellulose synthase operon protein C ; membrane outer biosynthesis Repeat Signal TPR

Pubmed 9630539

 

prodomImg

pubmed

36

527

S=428 I=31 E=1.72826e-42

Cellulose synthase operon protein C ; membrane outer biosynthesis Repeat Signal TPR

Pubmed 2146681

 

prodomImg

pubmed

1210

1407

S=275 I=34 E=6.75069e-24

Cellulose synthase operon protein C ; membrane outer biosynthesis Repeat Signal TPR

Pubmed 2146681

 

prodomImg

pubmed

36

527

S=419 I=30 E=2.24306e-41

Cellulose synthase 1 operon protein C ; membrane outer biosynthesis Repeat Signal TPR

Pubmed 10382968

 

prodomImg

pubmed

1210

1407

S=274 I=32 E=9.00125e-24

Cellulose synthase 1 operon protein C ; membrane outer biosynthesis Repeat Signal TPR

Pubmed 10382968

 

prodomImg

pubmed

36

571

S=387 I=30 E=1.91088e-37

Cellulose synthase 2 operon protein C ; membrane outer biosynthesis Repeat Signal TPR

Pubmed 10382968

 

prodomImg

pubmed

1211

1407

S=293 I=36 E=4.33473e-26

Cellulose synthase 2 operon protein C ; membrane outer biosynthesis Repeat Signal TPR

Pubmed 10382968

 

prodomImg

sp_Pdown

sp|P58938|BCSC_XANAC

1

1509

S=6148 I=82 E=0

Cellulose synthase operon protein C ; biosynthesis Repeat Signal TPR

sp_Pdown

sp|P58937|BCSC_PSEFL

36

817

S=879 I=33 E=3.3468e-97

Cellulose synthase operon protein C ; biosynthesis Repeat Signal TPR

sp_Pdown

sp|P58937|BCSC_PSEFL

1199

1506

S=476 I=34 E=2.32679e-48

Cellulose synthase operon protein C ; biosynthesis Repeat Signal TPR

sp_Pdown

sp|O82861|BCSC2_ACEXY

36

527

S=448 I=32 E=5.17641e-45

Cellulose synthase operon protein C ; membrane outer biosynthesis Repeat Signal TPR

sp_Pdown

sp|O82861|BCSC2_ACEXY

1210

1407

S=265 I=33 E=7.45857e-23

Cellulose synthase operon protein C ; membrane outer biosynthesis Repeat Signal TPR

PD017941

1189

1367

S=362 I=47 E=3.88591e-36

PD017941

919

1050

S=201 I=41 E=1.10804e-16

PDA3H1Y5

1058

1154

S=346 I=79 E=2.78536e-34

PD677476

799

895

S=289 I=63 E=2.53791e-27

PDA0U0L2

656

727

S=273 I=79 E=2.0553e-25

PDA319Q2

449

505

S=267 I=95 E=1.31644e-24

PD144040

137

256

S=264 I=53 E=3.12079e-24

PDA0U0L0

568

656

S=252 I=64 E=6.89405e-23

PD133138

1367

1509

S=221 I=35 E=4.64121e-19

PDA761K7

344

398

S=206 I=73 E=2.74609e-17

PDA9M291

429

577

S=173 I=34 E=3.17421e-13

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Zb8mfvJ3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

19 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
bcsB XFF4834R_chr34120
XFF4834R_chr34110
XFF4834R_chr34110
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34130
XFF4834R_chr34130
ID bcsB
AC XFF4834R_chr34120
LT XFF4834R_chr34120
OR XFF4834R_chr from 3942780 to 3945140 on strand -
DE Putative cellulose synthase subunit B
IP Cellulose synthase BcsB, bacterial
CL 1.6.16 Cellulose biosynthesis GO:0030244
EC
GO InterPro
Biological Process: UDP-glucose metabolic process (GO:0006011)
Cellular Component: membrane (GO:0016020)

Curated
PM
AN An operon encoding 4 proteins required for bacterial cellulose biosynthesis (bcs) in Acetobacter xylinus (Gluconacetobacter xylinus) has been isolated via genetic complementation with strains lacking cellulose synthase activity [1]. Nucleotide sequence analysis showed the cellulose synthase operon to consist of 4 genes, designated bcsA, bcsB, bcsC and bcsD, all of which are required for maximal bacterial cellulose synthesis in A. xylinum. The calculated molecular mass of the protein encoded by bcsB is 85.3kDa [1]. BcsB encodes the catalytic subunit of cellulose synthase. The protein polymerises uridine 5'-diphosphate glucose to cellulose: UDP-glucose + (1,4-beta-D-glucosyl)(N) = UDP + (1,4-beta-D-glucosyl)(N+1). The enzyme is specifically activated by the nucleotide cyclic diguanylic acid. Sequence analysis suggests that BcsB contains several transmembrane (TM) domains, and shares a high degree of similarity with Escherichia coli YhjN.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120306)
MW 85000.9 Da
SQ 786 aa
 
........10........20........30........40........50
| | | | |
MRGVSFCFTRTQLMRMFPAVLSCALTLLAGLARAQPPMPAMPSAQAGSQM
QAATPSQVPVAFAAAPLPGGSTRAATLRELGIDYEITLRGVQGSAGVPFS
VRSDEIVTAATLTLKYSYSPSLLPDLSHLKVTINGVTVATLPTDKANAGK
LLSADLPIDPRLVTDYNQLDLQLIGHYTRDCEDPDHSSLWANVDAATSLS
LTTTPLALANNLALLPVPFFDVRDTRRLELPFYFPQRPDTATLQAAGTVA
SWFGSLAGYRGAVFPASTEALPASGNAVVFATPSTLPAQFATADSGVADI
RGPTVAVLANPNDRNGKLLLVLGRNSEDLQRAATALALHAPLTGAVARIG
EISAPAPRRPYDAPNWVSSERPVRFGDLVTQPSQLNVTGYHPDLIRVGLQ
LPPDLFVWERDGIPVALNYRYTLPDNKSALNVSINESFVTTLPLTGRPFA
ESTPMRWWNSLGTRGSMPVHQDLTLPVGAFSANSQLRFHFFFDRPQGEAC
KNTFPDVSGAIDADSTIDLSGFHHYMAMPNLAAFANAGYPFTRLADLSES
AIVLPDNPGDQDLSNVLTLLGHFGASTGYPALHAQIIGAGAVQQHAGRDL
LLLGSAQSQPLFKQWRAHLPIGQDGRAPRFALTDWLFERLPRFLSFDARR
TDLPTTAEIALQPQPDDVLLMGFESPLKSGRSVVAFQTEDPANMSRLFDA
WFDPTLLKDFQGSVVLLQQNKVTSLIGNQTYYVGHLPLPTWLRWYFSHHP
VWLAFTVVLLALLLALAARVLLRRHTAERLNDGGGA
XFF4834R

NP_643824.3 lcl|XAC3517-XAC3517

1

786

S=3483 I=86 E=0

cellulose synthase regulator protein

XFF4834R

YP_365373.1 lcl|bcsB-XCV3642

1

786

S=3432 I=86 E=0

cellulose synthase regulator protein

pubmed

99

753

S=1196 I=39 E=7.60353e-136

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Transmembrane

Pubmed 12019221

 

prodomImg

pubmed

86

754

S=861 I=34 E=3.09943e-95

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Signal Transmembrane

Pubmed 11260463,11929533

 

prodomImg

pubmed

86

754

S=859 I=33 E=5.70606e-95

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Signal Transmembrane

Pubmed 8041620

 

prodomImg

pubmed

72

750

S=687 I=32 E=3.65748e-74

Putative cellulose synthase 3 EC=2.4.1.12 ; inner membrane biosynthesis Glycosyltransferase Transmembrane

Pubmed 10382968

 

prodomImg

pubmed

72

750

S=683 I=32 E=1.13613e-73

Putative cellulose synthase 2 EC=2.4.1.12 ; inner membrane biosynthesis Glycosyltransferase Transmembrane

Pubmed 10382968

 

prodomImg

pubmed

53

753

S=670 I=30 E=5.08562e-72

Cellulose synthase 2 EC=2.4.1.12 ; inner membrane biosynthesis Glycosyltransferase Transmembrane

Pubmed 7665515

 

prodomImg

pubmed

76

750

S=661 I=31 E=5.84205e-71

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Signal Transmembrane

Pubmed 10382968

 

prodomImg

pubmed

76

750

S=654 I=31 E=4.49373e-70

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Signal Transmembrane

Pubmed 9630539

 

prodomImg

pubmed

76

750

S=652 I=31 E=7.45117e-70

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Signal Transmembrane

Pubmed 2146681,1647035

 

prodomImg

pubmed

76

751

S=631 I=29 E=2.31071e-67

Cellulose synthase 1 EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

Pubmed 2151718,1830823

 

prodomImg

sp_Pdown

sp|P58933|BCSB_XANAC

1

786

S=3483 I=86 E=0

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Signal Transmembrane

sp_Pdown

sp|P58934|BCSB_PSEFL

99

753

S=1196 I=39 E=5.23572e-136

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Transmembrane

sp_Pdown

sp|Q8X5L8|BCSB_ECO57

86

751

S=867 I=32 E=3.69961e-96

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Signal Transmembrane

sp_Pdown

sp|Q8Z290|BCSB_SALTI

86

754

S=865 I=34 E=7.8306e-96

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Signal Transmembrane

sp_Pdown

sp|Q93IN1|BCSB_SALTY

86

754

S=861 I=34 E=2.13424e-95

Cyclic di-GMP-binding protein ; c-di-GMP Cell inner membrane Cellulose biosynthesis Signal Transmembrane

Iprscan IPR003920 [PR01440]

99

120

Cellulose synthase, subunit B

Iprscan IPR003920 [PR01440]

189

210

Cellulose synthase, subunit B

Iprscan IPR003920 [PR01440]

231

254

Cellulose synthase, subunit B

Iprscan IPR003920 [PR01440]

275

292

Cellulose synthase, subunit B

Iprscan IPR003920 [PR01440]

399

420

Cellulose synthase, subunit B

Iprscan IPR003920 [PR01440]

528

547

Cellulose synthase, subunit B

Iprscan IPR003920 [PR01440]

565

585

Cellulose synthase, subunit B

Iprscan IPR003920 [PR01440]

725

745

Cellulose synthase, subunit B

Iprscan IPR018513 [PF03170]

68

686

Cellulose synthase BcsB, bacterial

Iprscan [seg]

34

46

-

Iprscan [seg]

111

130

-

Iprscan [seg]

195

216

-

Iprscan [seg]

332

345

-

Iprscan [seg]

757

774

-

Iprscan [SignalP-NN(euk)]

1

34

-

Iprscan [tmhmm]

13

32

-

Iprscan [tmhmm]

750

772

-

PD011904

78

676

S=1177 I=42 E=7.19131e-135

PDA3J9M7

686

752

S=361 I=97 E=4.67135e-36

PD681563

1

72

S=259 I=75 E=1.03145e-23

PDA9W166

640

685

S=231 I=100 E=3.08646e-20

PD681565

647

749

S=141 I=30 E=2.45928e-09

PD520742

690

756

S=108 I=36 E=2.53807e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 87xlTK4K)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

13 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34120.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34120.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
bcsA XFF4834R_chr34130
XFF4834R_chr34120
XFF4834R_chr34120
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr34140
XFF4834R_chr34140
ID bcsA
AC XFF4834R_chr34130
LT XFF4834R_chr34130
OR XFF4834R_chr from 3945146 to 3947341 on strand -
DE probable cellulose synthase catalytic subunit [UDP-forming]
IP Cellulose synthase catalytic subunit (UDP-forming)
CL 1.6.16 Cellulose biosynthesis GO:0030244
EC
GO InterPro
Biological Process: cellulose biosynthetic process (GO:0030244)
Biological Process: UDP-glucose metabolic process (GO:0006011)
Cellular Component: membrane (GO:0016020)
Cellular Component: integral to plasma membrane (GO:0005887)
Molecular Function: cellulose synthase activity (GO:0016759)
Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Curated
PM
AN start change (multialign) These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate.
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100811)
MW 81141.8 Da
SQ 731 aa
 
........10........20........30........40........50
| | | | |
MRLRLVVPHAAMPEGRLMTAASRRSASPLPTLATWALWLLGALLLVFVVA
VPMDVTQQLVFSGVLFAVALAVRNSGGRVVILMMMGMSLAVSCRYIWWRM
TQTMGVGSAVDFILGLGLLGAELYAFVILVLGYFQVLWPLNRKPVPLPAD
QRLWPSVDVFIPTYNEPLSVVRTTVLAASVIDWPAGKITIHLLDDGRRDE
FRAFCAEVGINYVTRTNNAHAKAGNINAALKKCSGDYVAIFDCDHIPTRS
FLQVAMGWFLHDTRLALVQMPHYFFSPDPFERNLDTHGKVPNEGELFYGL
LQDGNDQWNATFFCGSCAVIKRTALEEVGGVAVETVTEDAHTALKLQRRG
YRTAYLAVPQAAGLATESLSGHVAQRIRWARGMAQIARIDNPLLGRGLKL
SQRLCYLNAMLHFFYGVPRIIYLTAPLAYLFFGAHVIQASALMILAYALP
HILQANLTNLRVQSRFRHLLWNEVYETTLAWYIFRPTLVALLNPKLGKFN
VTPKGGLVARSYFDAQIAKPYLFLLLLNVVGVVAGVLRLIYVGGSGEQQT
IWFNLTWTLYNMVLLGATIATASETRQVRSAHRVPLDVPVTLYLPDGGVL
PSRSVNFSTGGMAIMLAQPQPIEPGLPVQIGLSHRGVEQTLPAVVRQDRD
GQVSIQFTQMSMEQERWLVASTFARADIWLSQWGQHDRDAFWRSMGQVLE
ASARGFGRLGGHIVDSARQGFRPRRAVDLES
XFF4834R

NP_643825.2 lcl|bcsA-XAC3518

1

731

S=3483 I=91 E=0

celullose synthase

XFF4834R

YP_365375.1 lcl|bcsA-XCV3644

1

453

S=2107 I=89 E=0

cellulose synthase catalytic subunit [UDP-forming] (fragment)

XFF4834R

YP_365374.1 lcl|bcsA-XCV3643

462

731

S=1294 I=91 E=2.83908e-149

cellulose synthase catalytic subunit [UDP-forming] (fragment)

pubmed

52

710

S=1856 I=53 E=0

Cellulose synthase catalytic subunit [UDP-forming] EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

Pubmed 12019221

 

prodomImg

pubmed

52

722

S=1762 I=49 E=0

Cellulose synthase catalytic subunit [UDP-forming] EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

Pubmed 8041620

 

prodomImg

pubmed

52

722

S=1733 I=50 E=0

Cellulose synthase catalytic subunit [UDP-forming] EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

Pubmed 11260463,11929533

 

prodomImg

pubmed

57

714

S=1492 I=45 E=1.13883e-171

Cellulose synthase 1 EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

Pubmed 2151718,1830823

 

prodomImg

pubmed

53

723

S=1449 I=42 E=2.03396e-166

Cellulose synthase 1 catalytic subunit [UDP-forming] EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

Pubmed 10382968

 

prodomImg

sp_Pdown

sp|P58932|BCSA_XANAC

5

731

S=3471 I=91 E=0

Cellulose synthase catalytic subunit [UDP-forming] EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

sp_Pdown

sp|P58931|BCSA_PSEFS

52

710

S=1856 I=53 E=0

Cellulose synthase catalytic subunit [UDP-forming] EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

sp_Pdown

sp|P37653|BCSA_ECOLI

52

722

S=1762 I=49 E=0

Cellulose synthase catalytic subunit [UDP-forming] EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

sp_Pdown

sp|Q8X5L7|BCSA_ECO57

52

722

S=1749 I=49 E=0

Cellulose synthase catalytic subunit [UDP-forming] EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

sp_Pdown

sp|Q93IN2|BCSA_SALTY

52

722

S=1733 I=50 E=0

Cellulose synthase catalytic subunit [UDP-forming] EC=2.4.1.12 ; c-di-GMP inner membrane biosynthesis Glycosyltransferase Transmembrane

Iprscan IPR003919 [PR01439]

81

101

Cellulose synthase, subunit A

Iprscan IPR003919 [PR01439]

109

134

Cellulose synthase, subunit A

Iprscan IPR003919 [PR01439]

164

183

Cellulose synthase, subunit A

Iprscan IPR003919 [PR01439]

245

269

Cellulose synthase, subunit A

Iprscan IPR003919 [PR01439]

406

432

Cellulose synthase, subunit A

Iprscan IPR003919 [PR01439]

435

454

Cellulose synthase, subunit A

Iprscan IPR003919 [PR01439]

475

494

Cellulose synthase, subunit A

Iprscan IPR003919 [PR01439]

515

539

Cellulose synthase, subunit A

Iprscan IPR003919 [PR01439]

550

571

Cellulose synthase, subunit A

Iprscan [G3DSA:3.90.550.10]

155

351

-

Iprscan IPR001173 [PF00535]

158

329

Glycosyl transferase, family 2

Iprscan IPR009875 [PF07238]

577

673

Type IV pilus assembly PilZ

Iprscan IPR017480 [TIGR03030]

25

717

Cellulose synthase catalytic subunit (UDP-forming)

Iprscan [seg]

28

51

-

Iprscan [seg]

114

120

-

Iprscan [seg]

326

338

-

Iprscan [seg]

522

539

-

Iprscan [SignalP-NN(euk)]

1

50

-

Iprscan [tmhmm]

29

51

-

Iprscan [tmhmm]

55

72

-

Iprscan [tmhmm]

79

98

-

Iprscan [tmhmm]

113

135

-

Iprscan [tmhmm]

404

423

-

Iprscan [tmhmm]

427

449

-

Iprscan [tmhmm]

522

541

-

Iprscan [tmhmm]

551

573

-

PD545195

94

222

S=386 I=50 E=4.58834e-39

PDA0L4W1

5

94

S=283 I=69 E=1.36271e-26

PDA2P1D2

681

731

S=261 I=98 E=5.25517e-24

PD151461

589

710

S=242 I=47 E=1.10081e-21

PD305504

383

453

S=238 I=65 E=4.10654e-21

PDA040M9

471

592

S=236 I=42 E=6.18646e-21

PD711258

279

314

S=145 I=69 E=6.23772e-10

PD806361

296

389

S=121 I=35 E=5.55537e-07

PD604932

217

304

S=116 I=31 E=2.36196e-06

PD007872

315

382

S=112 I=40 E=6.66602e-06

Iprscan [SSF53448]

155

359

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nSfWkscj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

88 hits
swiss-prot

Swiss-Prot ncbi-blastp

73 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

27 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34130.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34130.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEMzceD/XFF4834R_chr34130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.