Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr11210acpPXFF4834R_chr11210acyl carrier protein (ACP)
  2. XFF4834R_chr39680XFF4834R_chr42920087_4569356_r2_XFF4834R-XFF4834R_chr39680XFF4834R_chr39680putative acyl carrier protein, xanthomonadin biosynthesis

acpP XFF4834R_chr11210
XFF4834R_chr11200
XFF4834R_chr11200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11220
XFF4834R_chr11220
ID acpP
AC XFF4834R_chr11210
LT XFF4834R_chr11210
OR XFF4834R_chr from 1251885 to 1252124 on strand +
DE acyl carrier protein (ACP)
IP Acyl carrier protein-like
CL 1.6.15.4 Acyl carrier protein GO:0042967
EC
GO InterPro
Biological Process: fatty acid biosynthetic process (GO:0006633)
Molecular Function: acyl carrier activity (GO:0000036)
Molecular Function: phosphopantetheine binding (GO:0031177)
Molecular Function: cofactor binding (GO:0048037)

Curated
PM
AN FEMS Microbiol Lett. 2000 Dec 1;193(1):129-36. Characterization of the acyl carrier protein gene and the fab gene locus in Xanthomonas albilineans.
CC COG: [IQ] Lipid transport and metabolism;Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100824)
MW 8802.8 Da
SQ 79 aa
 
........10........20........30........40........50
| | | | |
MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEE
FECEIPDEEAEKITSVQQAIDYVKAHVKS
Show or not Domain decomposition
 
XFF4834R

YP_362878.1 lcl|acpP-XCV1147

1

79

S=301 I=82 E=1.95577e-30

acyl carrier protein

XFF4834R

NP_636395.1 lcl|acpP-XCC1019

1

79

S=301 I=82 E=1.95577e-30

acyl carrier protein

XFF4834R

NP_641465.1 lcl|acpP-XAC1128

1

79

S=301 I=82 E=1.95577e-30

acyl carrier protein

XFF4834R

lcl|acpP-XALc_0627

1

79

S=291 I=80 E=2.81831e-29

probable acyl carrier protein (acp).

pubmed

1

79

S=291 I=80 E=1.49295e-27

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 11094291

 

prodomImg

pubmed

1

76

S=260 I=72 E=1.08713e-23

Acyl carrier protein 1 ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 10464226

 

prodomImg

pubmed

1

76

S=253 I=70 E=7.46618e-23

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 9171419

 

prodomImg

pubmed

1

76

S=246 I=67 E=4.23266e-22

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 1556094,8359454

 

prodomImg

pubmed

1

76

S=244 I=68 E=7.99886e-22

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Pubmed 9171419

 

prodomImg

sp_Pdown

sp|P63447|ACP_XANCP

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

sp_Pdown

sp|B0RYI4|ACP_XANCB

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

sp_Pdown

sp|Q4URQ3|ACP_XANC8

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

sp_Pdown

sp|Q3BWI5|ACP_XANC5

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

sp_Pdown

sp|P63446|ACP_XANAC

1

79

S=301 I=82 E=6.3791e-29

Acyl carrier protein ; Cytoplasm Fatty acid biosynthesis Lipid Phosphopantetheine

Iprscan [G3DSA:1.10.1200.10]

4

73

-

Iprscan IPR003231 [MF_01217]

3

77

Acyl carrier protein (ACP)

Iprscan [PTHR20863:SF5]

1

77

-

Iprscan [PTHR20863]

1

77

-

Iprscan IPR006163 [PF00550]

6

73

Phosphopantetheine-binding

Iprscan IPR003231 [TIGR00517]

1

77

Acyl carrier protein (ACP)

Iprscan IPR006162 [PS00012]

32

47

Phosphopantetheine attachment site

Iprscan IPR009081 [PS50075]

4

74

Acyl carrier protein-like

Iprscan [seg]

48

61

-

PDA1D7S2

2

33

S=125 I=84 E=1.10518e-07

PD000887

34

77

S=110 I=52 E=7.01147e-06

PDA19706

3

39

S=109 I=59 E=9.59673e-06

PDA1O107

16

40

S=103 I=84 E=4.49091e-05

Iprscan IPR009081 [SSF47336]

1

73

Acyl carrier protein-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one trtD4VjR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

57 hits
swiss-prot

Swiss-Prot ncbi-blastp

491 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3lCIMP/XFF4834R_chr11210.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3lCIMP/XFF4834R_chr11210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3lCIMP/XFF4834R_chr11210.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3lCIMP/XFF4834R_chr11210.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr42920087_4569356_r2_XFF4834R-XFF4834R_chr39680 XFF4834R_chr39680
XFF4834R_chr39670
XFF4834R_chr39670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39690
XFF4834R_chr39690
ID XFF4834R_chr42920087_4569356_r2_XFF4834R-XFF4834R_chr39680
AC XFF4834R_chr39680
LT XFF4834R_chr39680
OR XFF4834R_chr from 4569087 to 4569434 on strand -
DE putative acyl carrier protein, xanthomonadin biosynthesis
IP Acyl carrier protein-like
CL 1.6.15.4 Acyl carrier protein GO:0042967
EC
GO InterPro
Molecular Function: acyl carrier activity (GO:0000036)
Molecular Function: cofactor binding (GO:0048037)

Curated
PM
AN orthologous to orf 10 of the pig cluster: XOO4070 and XCC4012. orf10 is homologous to acyl carrier proteins (ACPs) from various prokaryotic and eukaryotic organisms. The ACPs are important constituents of PKS-FAS biosynthetic pathways. A conserved phosphopantethein attachment domain (pfam00550) has been identified in this ORF (Fig. ​(Fig.2A).2A). Phosphopantethein is the prosthetic group that attaches to a conserved serine residue (Fig. ​(Fig.2A)2A) in ACPs and serves as a swinging arm for the attachment of activated fatty acyl groups. The homology of the orf10 product to ACPs is significant because, to our knowledge, it is the first genetic evidence to indicate that PKS-FAS biosynthetic pathways may be involved in xanthomonadin production.
CC COG: [IQ] Lipid transport and metabolism;Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120309)
MW 12741.2 Da
SQ 115 aa
 
........10........20........30........40........50
| | | | |
MPADGRPRCSCLFSLLLPDPDLWKSWMSSQTAAERELAELLVESLNLEDV
QPADIDPEAPLFNTGLGLDSIDALELALAISKRYGFQLRSDNDENRRIFA
SLRALSAHVQANKTV
XFF4834R

YP_365920.1 XCV4189

1

115

S=526 I=89.57 E=2.60467e-57

acyl carrier protein

xanc5

XFF4834R

NP_644400.2 acpC-XAC4101

27

115

S=395 I=88.76 E=1.61907e-41

acyl carrier protein

xanac

XFF4834R

NP_639351.2 acpC-XCC4012

27

115

S=387 I=86.52 E=1.46977e-40

acyl carrier protein

xancp

XFF4834R

XALc_0128 XALc_0128

27

114

S=361 I=84.09 E=2.18949e-37

putative acyl carrier protein

xanal

pubmed

3

115

S=487 I=84.96 E=3.94289e-51

Putative acyl carrier protein

Pubmed 12057948

 

prodomImg

pubmed

42

113

S=179 I=48.61 E=8.09161e-14

Putative uncharacterized protein

Pubmed 15292145

 

prodomImg

pubmed

42

112

S=107 I=42.25 E=3.99807e-05

Acyl carrier protein homolog AcpC

Pubmed 10322024,10913694

 

prodomImg

Iprscan IPR009081 [G3DSA:1.10.1200.10]

30

112

Acyl carrier protein-like

Iprscan IPR006163 [PF00550]

36

108

Phosphopantetheine-binding

Iprscan IPR009081 [PS50075]

33

107

Acyl carrier protein-like

Iprscan [seg]

32

41

-

PD894381

1

31

S=142 I=87.1 E=9.67366e-10

Iprscan IPR009081 [SSF47336]

30

111

Acyl carrier protein-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Ow9vb3qW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3lCIMP/XFF4834R_chr39680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3lCIMP/XFF4834R_chr39680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3lCIMP/XFF4834R_chr39680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3lCIMP/XFF4834R_chr39680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.