Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr10480grxCXFF4834R_chr10480putative glutaredoxin
  2. XFF4834R_chr11480grxDXFF4834R_chr11480putative glutaredoxin-like protein
  3. XFF4834R_chr27550bcpXFF4834R_chr27550putative AhpC/TSA family peroxiredoxin
  4. XFF4834R_chr37220trxAXFF4834R_chr37220probable thioredoxin
  5. XFF4834R_chr39380XFF4834R_chr42580779_4534105_r3_XFF4834R-XFF4834R_chr39380XFF4834R_chr39380Putative thioredoxin

grxC XFF4834R_chr10480
XFF4834R_chr10470
XFF4834R_chr10470
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10490
XFF4834R_chr10490
ID grxC
AC XFF4834R_chr10480
LT XFF4834R_chr10480
OR XFF4834R_chr from 1192000 to 1192341 on strand +
DE putative glutaredoxin
IP Glutaredoxin, GrxC; Thioredoxin-like fold
CL 1.6.15.2 Thioredoxin, glutaredoxin GO:0042964 GO:0042965
EC
GO InterPro
Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100621)
MW 12108.6 Da
SQ 113 aa
 
........10........20........30........40........50
| | | | |
VSDLTPTTEFPVSQDHTDQDAASGPQITLYSSAICPYCVAAKNFLKSKGK
TWTEVRIDLDPAERDKMIALAKRTSVPQIFVGDVHVGGYDDMMAMHRAGK
LEPLLAGSAGGQA
Show or not Domain decomposition
 
XFF4834R

NP_641391.1 lcl|grxC-XAC1044

1

113

S=600 I=99 E=2.69416e-66

glutaredoxin

XFF4834R

YP_362805.1 lcl|XCV1074

1

113

S=596 I=98 E=7.60357e-66

putative glutaredoxin

XFF4834R

NP_636351.1 lcl|grxC-XCC0965

6

113

S=535 I=91 E=1.82354e-58

glutaredoxin

XFF4834R

lcl|XALc_0577

17

106

S=400 I=81 E=3.67795e-42

putative glutaredoxin protein

Iprscan IPR014025 [PR00160]

27

45

Glutaredoxin subgroup

Iprscan IPR014025 [PR00160]

69

82

Glutaredoxin subgroup

Iprscan IPR014025 [PR00160]

83

96

Glutaredoxin subgroup

Iprscan IPR012335 [G3DSA:3.40.30.10]

14

105

Thioredoxin fold

Iprscan [PTHR10168:SF10]

25

105

-

Iprscan [PTHR10168]

25

105

-

Iprscan IPR002109 [PF00462]

27

86

Glutaredoxin

Iprscan IPR011900 [TIGR02181]

27

105

Glutaredoxin, GrxC

Iprscan IPR011767 [PS00195]

29

45

Glutaredoxin active site

Iprscan IPR002109 [PS51354]

15

112

Glutaredoxin

Iprscan IPR012336 [SSF52833]

25

102

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VY81dX3w)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

42 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr10480.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr10480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr10480.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr10480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
grxD XFF4834R_chr11480
XFF4834R_chr11470
XFF4834R_chr11470
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11490
XFF4834R_chr11490
ID grxD
AC XFF4834R_chr11480
LT XFF4834R_chr11480
OR XFF4834R_chr from 1280384 to 1281310 on strand -
DE putative glutaredoxin-like protein
IP FeS cluster biogenesis; Rhodanese-like; Glutaredoxin-related protein; Thioredoxin-like fold
CL 1.6.15.2 Thioredoxin, glutaredoxin GO:0042964 GO:0042965
EC
GO InterPro
Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
Molecular Function: electron carrier activity (GO:0009055)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100621)
MW 32905.9 Da
SQ 308 aa
 
........10........20........30........40........50
| | | | |
MSLDPALRSRIDTLLQSSRVVLFMKGQPGMPQCGFSAKAVGVLDGLGVDY
AHVNVLADQEIREGIKAYGDWPTIPQLYVDGELIGGSDIIVQMADSGELS
SMLGLQAPDRSPPKITITPAAVEMLKGALADAPDASLTLAINANFQPNFQ
LAPTNPNAIAAESNGLRVQFDLASARRADGITIDWVDDIRGRGLAINNPN
APKPVQELSVRDADDRLKAGSLTLVDVRPADERALAMVAAPFRTLDAHER
AAIEQLPKDTPLAFLCHRGGRSLQAAEHFRGLGFTNVYNVTGGIDAWSDE
VDNGVAKY
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr26720 lcl|XFF4834R_chr29250890_3086162_r2_XFF4834R-XFF4834R_chr26720

10

83

S=172 I=45 E=2.53649e-14

XFF4834R

XFF4834R_chr21260 lcl|moeB-XFF4834R_chr21260

182

299

S=100 I=28 E=1.32059e-05

molybdopterin synthase sulfurylase

XFF4834R

NP_643807.2 lcl|XAC3500-XAC3500

1

308

S=1591 I=99 E=0

glutaredoxin-like protein

XFF4834R

YP_365357.1 lcl|grx-XCV3626

1

308

S=1586 I=98 E=0

glutaredoxin-like protein

XFF4834R

NP_638714.2 lcl|XCC3368

1

308

S=1554 I=96 E=0

glutaredoxin-like protein

XFF4834R

lcl|XALc_0868

1

308

S=1294 I=80 E=9.11665e-150

putative glutaredoxin-like protein.

XFF4834R

NP_637850.1 lcl|XCC2500

9

103

S=236 I=46 E=1.35841e-21

hypothetical protein

XFF4834R

lcl|XALc_1275

9

103

S=233 I=46 E=3.54442e-21

putative glutaredoxin-related protein precursor

XFF4834R

YP_364557.1 lcl|XCV2826

9

104

S=229 I=43 E=1.12038e-20

glutaredoxin-related protein

XFF4834R

NP_642987.1 lcl|XAC2676-XAC2676

9

104

S=229 I=43 E=1.12038e-20

hypothetical protein

XFF4834R

NP_637354.1 lcl|moeB-XCC1989

206

298

S=102 I=33 E=2.36238e-05

molybdopterin biosynthesis protein MoeB

XFF4834R

YP_363805.1 lcl|moeB-XCV2074

200

298

S=97 I=31 E=9.69982e-05

molybdopterin biosynthesis protein MoeB

Iprscan IPR012335 [G3DSA:3.40.30.10]

7

103

Thioredoxin fold

Iprscan IPR000361 [G3DSA:2.60.300.12]

106

199

FeS cluster biogenesis

Iprscan IPR001763 [G3DSA:3.40.250.10]

202

299

Rhodanese-like

Iprscan IPR004480 [PTHR10293]

1

124

Glutaredoxin-related protein

Iprscan IPR002109 [PF00462]

20

84

Glutaredoxin

Iprscan IPR001763 [PF00581]

212

299

Rhodanese-like

Iprscan IPR001763 [SM00450]

208

303

Rhodanese-like

Iprscan IPR004480 [TIGR00365]

7

105

Glutaredoxin-related protein

Iprscan IPR001763 [PS50206]

218

306

Rhodanese-like

Iprscan IPR002109 [PS51354]

8

110

Glutaredoxin

Iprscan IPR012336 [SSF52833]

10

106

Thioredoxin-like fold

Iprscan IPR001763 [SSF52821]

202

306

Rhodanese-like

Iprscan IPR000361 [SSF89360]

106

199

FeS cluster biogenesis

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VytC7X2n)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

35 hits
swiss-prot

Swiss-Prot ncbi-blastp

124 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr11480.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr11480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr11480.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr11480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
bcp XFF4834R_chr27550
XFF4834R_chr27540
XFF4834R_chr27540
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27560
XFF4834R_chr27560
ID bcp
AC XFF4834R_chr27550
LT XFF4834R_chr27550
OR XFF4834R_chr from 3184127 to 3184609 on strand +
DE putative AhpC/TSA family peroxiredoxin
IP Thioredoxin-like fold
CL 1.6.15.2 Thioredoxin, glutaredoxin GO:0042964 GO:0042965
EC
GO InterPro
Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: antioxidant activity (GO:0016209)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100621)
MW 17434.9 Da
SQ 160 aa
 
........10........20........30........40........50
| | | | |
MTDAVLELPAATFDLPLALSGGTQATLRDYAGKWLVLYFYPKDSTPGCTT
EGLDFNALLPQFKKAGAMVLGVSRDSVKSHDNFCAKQGFTFPLISDSDEA
LCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGHVVQEWRKVKVAGHAEAV
LAAVKAHAKQ
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr09130 lcl|ahpC-XFF4834R_chr09130

23

132

S=125 I=39 E=4.73337e-09

alkyl hydroperoxide reductase, C22 subunit

XFF4834R

NP_642085.1 lcl|XAC1757-XAC1757

1

141

S=740 I=98 E=4.58001e-83

bacterioferritin comigratory protein

XFF4834R

YP_363519.1 lcl|XCV1788

1

141

S=734 I=96 E=2.98514e-82

AhpC/TSA family peroxiredoxin

XFF4834R

NP_637105.1 lcl|XCC1738

1

141

S=687 I=89 E=1.30875e-76

bacterioferritin comigratory protein

XFF4834R

lcl|XALc_1182

8

141

S=612 I=83 E=1.44222e-67

hypothetical ahpc/tsa family peroxiredoxin protein

XFF4834R

YP_362674.1 lcl|ahpC-XCV0943

23

132

S=125 I=39 E=1.69243e-08

Alkyl hydroperoxide reductase subunit C

XFF4834R

NP_641259.1 lcl|ahpC-XAC0907

23

132

S=125 I=39 E=1.69243e-08

alkyl hydroperoxide reductase subunit C

XFF4834R

NP_636225.1 lcl|ahpC-XCC0834

23

132

S=124 I=39 E=2.06823e-08

alkyl hydroperoxide reductase subunit C

XFF4834R

lcl|ahpC-XALc_0460

24

132

S=123 I=36 E=2.9313e-08

probable alkyl hydroperoxide reductase subunit c (thioredoxin peroxidase) protein

Iprscan IPR012335 [G3DSA:3.40.30.10]

4

157

Thioredoxin fold

Iprscan [PTHR10681:SF5]

22

156

-

Iprscan [PTHR10681]

22

156

-

Iprscan IPR000866 [PF00578]

10

136

Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen

Iprscan IPR017936 [PS51352]

4

159

Thioredoxin-like

Iprscan [seg]

142

159

-

Iprscan IPR012336 [SSF52833]

6

156

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wSnsIwiY)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

206 hits
swiss-prot

Swiss-Prot ncbi-blastp

141 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr27550.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr27550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr27550.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr27550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
trxA XFF4834R_chr37220
XFF4834R_chr37210
XFF4834R_chr37210
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37230
XFF4834R_chr37230
ID trxA
AC XFF4834R_chr37220
LT XFF4834R_chr37220
OR XFF4834R_chr from 4304676 to 4305017 on strand +
DE probable thioredoxin
IP Thioredoxin; Thioredoxin-like fold
CL 1.6.15.2 Thioredoxin, glutaredoxin GO:0042964 GO:0042965
EC
GO InterPro
Biological Process: cell redox homeostasis (GO:0045454)
Biological Process: glycerol ether metabolic process (GO:0006662)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
Molecular Function: electron carrier activity (GO:0009055)

Curated
PM
AN according to GenProtEC
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120410)
MW 12181 Da
SQ 113 aa
 
........10........20........30........40........50
| | | | |
VSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTY
QGRLKVAKVNVDQNRALAIKYHVRSIPMLLLFKDGQVQATQIGAVGKGQL
TQMIDKTLGGAAA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr18490 lcl|XFF4834R_chr19810685_2113542_r1_XFF4834R-XFF4834R_chr18490

1

104

S=230 I=43 E=4.61059e-22

predicted thioredoxin domain-containing protein

XFF4834R

XFF4834R_chr32580 lcl|trxC-XFF4834R_chr32580

11

109

S=195 I=37 E=9.07096e-18

thioredoxin 2

XFF4834R

YP_365686.1 lcl|trxA-XCV3955

1

113

S=584 I=99 E=2.16289e-64

thioredoxin

XFF4834R

NP_644136.1 lcl|trxA-XAC3830

1

113

S=580 I=98 E=5.49783e-64

thioredoxin

XFF4834R

NP_639122.1 lcl|trxA-XCC3777

1

113

S=575 I=96 E=2.27715e-63

thioredoxin

XFF4834R

lcl|XALc_2881

1

113

S=535 I=89 E=1.57234e-58

putative thioredoxin protein

XFF4834R

lcl|XALc_2482

13

104

S=237 I=48 E=2.40097e-22

putative thioredoxin domain-containing protein

XFF4834R

NP_643092.1 lcl|trx-XAC2783

1

104

S=231 I=43 E=1.38508e-21

thioredoxin

XFF4834R

YP_364671.1 lcl|XCV2940

1

104

S=230 I=43 E=1.64894e-21

thioredoxin

XFF4834R

NP_637970.1 lcl|trx-XCC2622

1

104

S=230 I=43 E=1.83081e-21

thioredoxin

XFF4834R

NP_636554.1 lcl|trx-XCC1180

8

100

S=214 I=42 E=1.40709e-19

thioredoxin

XFF4834R

YP_364044.1 lcl|XCV2313

5

108

S=213 I=39 E=2.02934e-19

putative thioredoxin

XFF4834R

YP_363058.1 lcl|XCV1327

11

109

S=200 I=38 E=6.08264e-18

putative thioredoxin

XFF4834R

NP_641612.1 lcl|trx-XAC1277

11

109

S=198 I=38 E=1.27628e-17

thioredoxin

XFF4834R

YP_361811.1 lcl|XCV0080

6

86

S=97 I=32 E=1.93701e-05

putative thioredoxin

pubmed

1

108

S=369 I=60 E=7.04186e-37

Thioredoxin-1 ; Disulfide bond Electron transport Redox-active center

Pubmed 1561103,8253691

 

prodomImg

pubmed

1

108

S=369 I=60 E=7.04186e-37

Thioredoxin-1 ; Acetylation Disulfide bond Electron transport Host-virus interaction Redox-active center

Pubmed 6098320,6099324

 

prodomImg

pubmed

1

108

S=349 I=56 E=1.5408e-34

Thioredoxin ; Disulfide bond Electron transport Redox-active center

Pubmed 7496529

 

prodomImg

pubmed

2

108

S=344 I=54 E=7.79897e-34

Thioredoxin

Pubmed 17294328

 

prodomImg

pubmed

1

108

S=338 I=56 E=4.12344e-33

Thioredoxin ; Disulfide bond Electron transport Redox-active center

Pubmed 10224002

 

prodomImg

sp_Pdown

sp|P0AA30|THIO_SHIFL

1

108

S=369 I=60 E=5.04915e-37

Thioredoxin-1 ; Acetylation Disulfide bond Electron transport Redox-active center

sp_Pdown

sp|P0AA28|THIO_SALTY

1

108

S=369 I=60 E=5.04915e-37

Thioredoxin-1 ; Disulfide bond Electron transport Redox-active center

sp_Pdown

sp|P0AA29|THIO_SALTI

1

108

S=369 I=60 E=5.04915e-37

Thioredoxin-1 ; Disulfide bond Electron transport Redox-active center

sp_Pdown

sp|P0AA25|THIO_ECOLI

1

108

S=369 I=60 E=5.04915e-37

Thioredoxin-1 ; Acetylation Disulfide bond Electron transport Host-virus interaction Redox-active center

sp_Pdown

sp|P0AA26|THIO_ECOL6

1

108

S=369 I=60 E=5.04915e-37

Thioredoxin-1 ; Acetylation Disulfide bond Electron transport Redox-active center

Iprscan IPR006662 [PR00421]

24

32

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

32

41

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

72

83

Thioredoxin-like subdomain

Iprscan IPR012335 [G3DSA:3.40.30.10]

2

111

Thioredoxin fold

Iprscan [PTHR10438:SF13]

14

108

-

Iprscan IPR015467 [PTHR10438]

14

108

Thioredoxin, core

Iprscan IPR013766 [PF00085]

5

106

Thioredoxin domain

Iprscan IPR005746 [TIGR01068]

8

108

Thioredoxin

Iprscan IPR017937 [PS00194]

25

43

Thioredoxin, conserved site

Iprscan IPR017936 [PS51352]

1

109

Thioredoxin-like

PD003146

24

76

S=156 I=55 E=1.72019e-11

PD236870

5

108

S=133 I=31 E=1.10959e-08

PDA8X8G8

7

109

S=130 I=30 E=2.72379e-08

PDA5I3A0

1

85

S=127 I=31 E=6.29041e-08

PDA4U1E6

24

108

S=127 I=34 E=6.92357e-08

PD772748

10

105

S=125 I=31 E=9.89867e-08

PDA519O9

12

87

S=115 I=32 E=1.59761e-06

PDA0U4W7

1

105

S=115 I=29 E=1.96946e-06

PD788968

20

106

S=112 I=30 E=3.85398e-06

PD946145

28

80

S=105 I=40 E=2.5785e-05

Iprscan IPR012336 [SSF52833]

1

109

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Gow6dmkH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

406 hits
swiss-prot

Swiss-Prot ncbi-blastp

335 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr37220.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr37220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr37220.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr37220.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr42580779_4534105_r3_XFF4834R-XFF4834R_chr39380 XFF4834R_chr39380
XFF4834R_chr39370
XFF4834R_chr39370
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39390
XFF4834R_chr39390
ID XFF4834R_chr42580779_4534105_r3_XFF4834R-XFF4834R_chr39380
AC XFF4834R_chr39380
LT XFF4834R_chr39380
OR XFF4834R_chr from 4533779 to 4534105 on strand -
DE Putative thioredoxin
IP Thioredoxin-like fold; DnaJ homolog, subfamily C
CL 1.6.15.2 Thioredoxin, glutaredoxin GO:0042964 GO:0042965
EC
GO InterPro
Biological Process: cell redox homeostasis (GO:0045454)

Curated
PM
AN
CC COG: [CO] Energy production and conversion;Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100817)
MW 11798.3 Da
SQ 108 aa
 
........10........20........30........40........50
| | | | |
MQTITVTSPEHYTQTLAAHPRALVDFYKDNCPGCRMLDMSLDKFANSDAA
NGVALLKVKLEVVGEDFFRDLGLRQTPTLALYRDGAEVARLPGFQSPAQV
EAAVRSGL
Show or not Domain decomposition
 
XFF4834R

NP_644371.1 lcl|trxA-XAC4072

1

108

S=571 I=100 E=6.81577e-63

thioredoxin

XFF4834R

NP_639322.1 lcl|trxA-XCC3983

1

108

S=522 I=89 E=6.60662e-57

thioredoxin

XFF4834R

YP_365889.1 lcl|XCV4158

1

108

S=507 I=87 E=3.67755e-55

putative thioredoxin

XFF4834R

lcl|XALc_0164

1

108

S=391 I=67 E=4.59956e-41

putative thioredoxin protein

pubmed

1

97

S=184 I=36 E=1.3955e-14

Gp60

Pubmed 16188359

 

prodomImg

pubmed

1

105

S=184 I=34 E=1.3955e-14

Gp128

Pubmed 18567664

 

prodomImg

pubmed

3

102

S=119 I=32 E=1.25944e-06

Thioredoxin ; Disulfide bond Electron transport Redox-active center

Pubmed 9359865,10632710

 

prodomImg

pubmed

11

101

S=118 I=26 E=1.69402e-06

Disulfide bond formation protein A ; Oxidoreductase Redox-active center Secreted Signal

Pubmed 10376821

 

prodomImg

pubmed

11

101

S=118 I=26 E=1.69402e-06

SPBc2 prophage-derived disulfide bond formation protein A ; Oxidoreductase Redox-active center Secreted Signal

Pubmed 10455116

 

prodomImg

sp_Pdown

sp|O83889|THIO_TREPA

8

100

S=120 I=28 E=5.83188e-07

Thioredoxin ; Disulfide bond Electron transport Redox-active center

sp_Pdown

sp|Q9UW02|THIO_COPCM

5

108

S=119 I=23 E=7.18927e-07

Thioredoxin ; Allergen Disulfide bond Electron transport Redox-active center

sp_Pdown

sp|P80579|THIO_ALIAC

3

102

S=119 I=32 E=8.7094e-07

Thioredoxin ; Disulfide bond Electron transport Redox-active center

sp_Pdown

sp|P68570|BDBA_BPSPC

11

101

S=118 I=26 E=1.17146e-06

Disulfide bond formation protein A ; Oxidoreductase Redox-active center Secreted Signal

sp_Pdown

sp|P68569|BDBA_BACSU

11

101

S=118 I=26 E=1.17146e-06

SPBc2 prophage-derived disulfide bond formation protein A ; Oxidoreductase Redox-active center Secreted Signal

Iprscan IPR012335 [G3DSA:3.40.30.10]

3

103

Thioredoxin fold

Iprscan IPR015467 [PTHR10438]

12

108

Thioredoxin, core

Iprscan IPR013766 [PF00085]

5

104

Thioredoxin domain

Iprscan IPR017936 [PS51352]

1

108

Thioredoxin-like

PD126139

1

108

S=400 I=66 E=5.6928e-41

PDA51894

8

108

S=103 I=29 E=4.93225e-05

PD788968

14

100

S=102 I=30 E=6.35117e-05

Iprscan IPR012336 [SSF52833]

3

106

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one F2X5AP7I)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr39380.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr39380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr39380.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnND3QJ/XFF4834R_chr39380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.