Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr22980XFF4834R_chr_2663434_2664612_r1_XFF4834R-XFF4834R_chr22980XFF4834R_chr22980putative tetratricopeptide repeat protein
  2. XFF4834R_chr33200XFF4834R_chr35880155_3816882_f1_XFF4834R-XFF4834R_chr33200XFF4834R_chr33200putative dolichyl-phosphate mannosyltransferase
  3. XFF4834R_chr36900XFF4834R_chr40040946_4269667_r3_XFF4834R-XFF4834R_chr36900XFF4834R_chr36900putative dolichyl-phosphate mannosyltransferase

XFF4834R_chr_2663434_2664612_r1_XFF4834R-XFF4834R_chr22980 XFF4834R_chr22980
XFF4834R_chr22970
XFF4834R_chr22970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr22990
XFF4834R_chr22990
ID XFF4834R_chr_2663434_2664612_r1_XFF4834R-XFF4834R_chr22980
AC XFF4834R_chr22980
LT XFF4834R_chr22980
OR XFF4834R_chr from 2663434 to 2664612 on strand -
DE putative tetratricopeptide repeat protein
IP Tetratricopeptide-like helical
CL 1.6.11 Glycoprotein GO:0009101
EC
GO InterPro
Molecular Function: binding (GO:0005488)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110111)
MW 44084.6 Da
SQ 392 aa
 
........10........20........30........40........50
| | | | |
MDFLTEWIWFFLFVPLAALGGWIVGRRGGQRHGDTQVSRLSSTYFRGLNY
LLNEQPDKAIELFLHIAELDKETFETQVALGHLFRRRGEVDRAIRLHQGL
VQRGDLTDQQRVQALLALGEDYMKSGLLDRAETVFTELAQLDQRAPQALR
HLIGIYQAERDWEKAIDNATRYEEVTGEPMGKLISQFECELADRYRGLGK
TDDALQAIARAYQADGTSVRAGILEGRIEAERGHDEAAVRAFERAARHDP
EYLPEIIPALMAAYRRVGDIAGARNFLSEMTEHYRGIAPVLALTQLMEAQ
DGVAPALAYLGRQLKDRPSVRGESALIDLTLAEGSDPVGTLQDLKHITDQ
LLVRNPSYRCTRCGFGAKTHHWQCPSCKEWGTVKPLLNYAVV
Show or not Domain decomposition
 
XFF4834R

YP_364224.1 lcl|XCV2493

1

392

S=2001 I=97 E=0

hypothetical protein

XFF4834R

NP_642612.1 lcl|XAC2295-XAC2295

1

392

S=2001 I=97 E=0

hypothetical protein

XFF4834R

NP_637547.1 lcl|XCC2191

1

392

S=1974 I=95 E=0

hypothetical protein

XFF4834R

lcl|XALc_1599

1

392

S=1772 I=84 E=0

hypothetical protein

pubmed

15

386

S=657 I=37 E=7.38894e-71

Uncharacterized protein yciM ; Metal-binding Repeat Signal TPR Zinc Zinc-finger

Pubmed 3052852

 

prodomImg

sp_Pdown

sp|P0AB58|YCIM_ECOLI

15

386

S=657 I=37 E=5.02524e-71

Uncharacterized protein yciM ; Metal-binding Repeat Signal TPR Zinc Zinc-finger

sp_Pdown

sp|P0AB59|YCIM_ECOL6

15

386

S=657 I=37 E=5.02524e-71

Uncharacterized protein yciM ; Metal-binding Repeat Signal TPR Zinc Zinc-finger

sp_Pdown

sp|P0AB60|YCIM_ECO57

15

386

S=657 I=37 E=5.02524e-71

Uncharacterized protein yciM ; Metal-binding Repeat Signal TPR Zinc Zinc-finger

sp_Pdown

sp|P44130|Y1223_HAEIN

10

388

S=504 I=31 E=1.89562e-52

Uncharacterized protein HI_1223 ; Metal-binding Repeat Signal TPR Zinc Zinc-finger

Iprscan IPR011990 [G3DSA:1.25.40.10]

44

286

Tetratricopeptide-like helical

Iprscan [PTHR23083]

34

302

-

Iprscan IPR019734 [SM00028]

40

73

Tetratricopeptide repeat

Iprscan IPR019734 [SM00028]

112

145

Tetratricopeptide repeat

Iprscan IPR019734 [SM00028]

185

218

Tetratricopeptide repeat

Iprscan IPR019734 [SM00028]

219

252

Tetratricopeptide repeat

Iprscan IPR013026 [PS50293]

40

252

Tetratricopeptide repeat-containing

Iprscan [seg]

236

247

-

Iprscan [SignalP-NN(euk)]

1

20

-

Iprscan [tmhmm]

7

24

-

PD042193

253

385

S=252 I=39 E=4.75929e-23

PD165048

15

84

S=207 I=53 E=1.24747e-17

PDA1G281

118

189

S=197 I=51 E=1.9614e-16

PDA1G125

70

118

S=159 I=65 E=7.68418e-12

Iprscan [SSF48452]

38

319

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YsVBFhnD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr22980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr22980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr22980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr22980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr35880155_3816882_f1_XFF4834R-XFF4834R_chr33200 XFF4834R_chr33200
XFF4834R_chr33190
XFF4834R_chr33190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr33210
XFF4834R_chr33210
ID XFF4834R_chr35880155_3816882_f1_XFF4834R-XFF4834R_chr33200
AC XFF4834R_chr33200
LT XFF4834R_chr33200
OR XFF4834R_chr from 3815155 to 3816882 on strand +
DE putative dolichyl-phosphate mannosyltransferase
IP Glycosyl transferase, family 39
CL 1.6.11 Glycoprotein GO:0009101
EC
GO InterPro
Biological Process: protein amino acid O-linked glycosylation (GO:0006493)
Cellular Component: membrane (GO:0016020)
Molecular Function: mannosyltransferase activity (GO:0000030)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100810)
MW 63591.5 Da
SQ 575 aa
 
........10........20........30........40........50
| | | | |
MSPAIAASSSRQRALLVALLLIVVSLLAGLGMRQPNPPDEPRFVLAARTM
VETGQWLLPHRGSELYAEKPPVFMWLQAATYELIPHWPVAFLLPSLLAAL
ATLWLTWDIARRLWTRRVAAYAVLALFTVLQFGLMAKRAQIDMVLVALTT
LSLWGMLRHLLRGPDWRAWTLGLFAAGVGTVTKGVGFLPLLLLLPWMALR
RTHWSVLPARALAGRSWGLVLPAFLAGTAVWLGPLGIALWHSDDPQLHAY
AHELLFKQTGTRYAHAWHHVKPFWYYLQVIATLWLPGCLLLPWLLPAWWR
RLRRGDPRYVLLLAWSMLVLLFFSASPGKREVYIFPMLPALCVAAAPLLA
GLLRRRGVRMLLTGYVLLLAIAGLVLGGGITLHLHWAENTAVKRGMELAS
LQSVGFWLIGLGVVGLAAIAWSRGKRAGAALVVMTATLWTVSGLGLMPAL
DPYSSSARLMQRVGQRIGPDAELGMLAWREQNLLQADRPVTDFGFKASWQ
DQWAKAGPWLAQAPHTRWLFVLKQAVPACIDPAQRIDIGESNRNQWQLLP
GTAWHAGCIATASDAEQTGSEGDAD
XFF4834R

XFF4834R_chr36900 lcl|XFF4834R_chr40040946_4269667_r3_XFF4834R-XFF4834R_chr36900

32

575

S=738 I=33 E=1.2591e-82

XFF4834R

NP_641556.2 lcl|XAC1220-XAC1220

32

575

S=2113 I=79 E=0

hypothetical protein

XFF4834R

YP_362983.1 lcl|XCV1252

32

575

S=2075 I=77 E=0

putative glycosyltransferase

XFF4834R

NP_636494.2 lcl|XCC1119

32

575

S=1742 I=66 E=0

hypothetical protein

XFF4834R

lcl|XALc_2855

33

567

S=777 I=35 E=8.09707e-87

putative glycosyltransferase protein

XFF4834R

NP_644104.1 lcl|XAC3798-XAC3798

32

575

S=767 I=33 E=1.45098e-85

hypothetical protein

XFF4834R

NP_639091.2 lcl|XCC3746

32

575

S=742 I=33 E=1.36166e-82

hypothetical protein

XFF4834R

YP_365654.1 lcl|XCV3923

32

575

S=740 I=33 E=2.75915e-82

putative dolichyl-phosphate mannosyltransferase

pubmed

32

575

S=2004 I=75 E=0

Putative uncharacterized protein ; Cell membrane

Pubmed 15195943

 

prodomImg

Iprscan IPR003342 [PF02366]

63

204

Glycosyl transferase, family 39

Iprscan [seg]

4

31

-

Iprscan [seg]

90

105

-

Iprscan [seg]

177

186

-

Iprscan [seg]

188

195

-

Iprscan [seg]

283

304

-

Iprscan [seg]

311

321

-

Iprscan [seg]

337

362

-

Iprscan [seg]

366

380

-

Iprscan [SignalP-NN(euk)]

1

29

-

Iprscan [tmhmm]

13

32

-

Iprscan [tmhmm]

83

105

-

Iprscan [tmhmm]

118

135

-

Iprscan [tmhmm]

174

196

-

Iprscan [tmhmm]

217

239

-

Iprscan [tmhmm]

274

296

-

Iprscan [tmhmm]

309

328

-

Iprscan [tmhmm]

332

354

-

Iprscan [tmhmm]

361

383

-

Iprscan [tmhmm]

398

420

-

Iprscan [tmhmm]

427

449

-

PDA1I4B9

447

571

S=440 I=62 E=1.00636e-45

PD605865

159

282

S=229 I=46 E=3.45893e-20

PDA1H2I1

32

69

S=144 I=71 E=5.94107e-10

PD572086

306

444

S=114 I=30 E=3.13328e-06

PDA2Q8Q8

70

89

S=102 I=85 E=9.14906e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one payKc09D)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

21 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr33200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr33200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr33200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr33200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr40040946_4269667_r3_XFF4834R-XFF4834R_chr36900 XFF4834R_chr36900
XFF4834R_chr36890
XFF4834R_chr36890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36910
XFF4834R_chr36910
ID XFF4834R_chr40040946_4269667_r3_XFF4834R-XFF4834R_chr36900
AC XFF4834R_chr36900
LT XFF4834R_chr36900
OR XFF4834R_chr from 4267946 to 4269667 on strand -
DE putative dolichyl-phosphate mannosyltransferase
IP Glycosyl transferase, family 39
CL 1.6.11 Glycoprotein GO:0009101
EC
GO InterPro
Biological Process: protein amino acid O-linked glycosylation (GO:0006493)
Cellular Component: membrane (GO:0016020)
Molecular Function: mannosyltransferase activity (GO:0000030)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100818)
MW 64323.5 Da
SQ 573 aa
 
........10........20........30........40........50
| | | | |
MFKNRASTDVWLLAMTAVLVIGAGLGLRDPWPADEPRFALVAKQMVLSGD
WLFPHRGNELYSDKPPMLMWLQAVFYTLLGNWRVAFLLPSLLAALGTLAC
VYDLGRRLWTRRVGVYAAWMLLFTLHFTFQAKKAQIDPLVVFWITLANYG
LLRHLLMGPAWRWWTLGWFAAGLGVITKGVGIIALLMLIPAGIAAARGWP
GVRAHVRDRRFWLGPLFFFVAIALWFVPMMVTALTAGQSEYRVYLNDILL
RQTAKRYASSWDHAQPVWYHLQSMATMWLPTILLLPWAIPAWRRRLKRRD
PRYLLPLAWWLLVLVFFTIPSGKRDVYILPALPMFCLALAPLAPGLLRRA
GVQRLLFGFGLLLAVVFCAGGAAMLIGHPGFEQKIMDSRGVGSEATDPLG
WLLLAVGTWGIASLLLMRVRRSALAVVSLLGAWWVAFGLVCYPIFNDSSS
AGAVMREAGRRIGPDAQLGLVAWKEQNLLMADRPAQTFGFKVPWETQLQR
GVAWQAEQPDQRWLMAQETALLACVDRSRSQLVGVANRRRWWLVPADAVR
GPCVASSSERAVEAKEQGNLDTE
XFF4834R

XFF4834R_chr33200 lcl|XFF4834R_chr35880155_3816882_f1_XFF4834R-XFF4834R_chr33200

24

571

S=855 I=38 E=9.18974e-97

XFF4834R

YP_365654.1 lcl|XCV3923

1

573

S=2522 I=87 E=0

putative dolichyl-phosphate mannosyltransferase

XFF4834R

NP_644104.1 lcl|XAC3798-XAC3798

1

573

S=2486 I=86 E=0

hypothetical protein

XFF4834R

NP_639091.2 lcl|XCC3746

1

573

S=2352 I=79 E=0

hypothetical protein

XFF4834R

lcl|XALc_2855

1

567

S=1568 I=59 E=0

putative glycosyltransferase protein

XFF4834R

NP_636494.2 lcl|XCC1119

24

573

S=906 I=40 E=1.80693e-102

hypothetical protein

XFF4834R

YP_362983.1 lcl|XCV1252

15

571

S=897 I=39 E=2.34517e-101

putative glycosyltransferase

XFF4834R

NP_641556.2 lcl|XAC1220-XAC1220

24

571

S=832 I=38 E=1.88971e-93

hypothetical protein

pubmed

27

571

S=838 I=38 E=1.35667e-92

Putative uncharacterized protein ; Cell membrane

Pubmed 15195943

 

prodomImg

pubmed

12

332

S=152 I=25 E=1.99191e-09

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosy

Pubmed 15583148

 

prodomImg

pubmed

5

332

S=152 I=26 E=2.04469e-09

Melittin resistance protein ; Cell membrane

Pubmed 17241198,17993540

 

prodomImg

pubmed

1

332

S=150 I=24 E=3.24574e-09

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosy

Pubmed 14973084

 

prodomImg

pubmed

12

333

S=149 I=25 E=4.76342e-09

Glycosyltransferase, family 39 Putative transmembrane protein ; Plasmid

Pubmed 7766206,11544228

 

prodomImg

sp_Pdown

sp|Q6D2F3|ARNT_ERWCT

31

332

S=173 I=27 E=4.18459e-12

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthesis

sp_Pdown

sp|Q2NRV9|ARNT2_SODGM

25

332

S=170 I=27 E=8.62845e-12

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthe

sp_Pdown

sp|Q4ZSZ0|ARNT_PSEU2

25

286

S=165 I=27 E=3.5428e-11

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthesis

sp_Pdown

sp|Q48HY9|ARNT_PSE14

26

286

S=163 I=28 E=6.93278e-11

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthesis

sp_Pdown

sp|B4ETL9|ARNT2_PROMH

1

330

S=154 I=25 E=7.62424e-10

Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 EC=2.4.2.n1 ; Cell inner membrane Glycosyltransferase Lipid biosynthe

Iprscan IPR003342 [PF02366]

61

233

Glycosyl transferase, family 39

Iprscan [seg]

85

99

-

Iprscan [seg]

293

315

-

Iprscan [seg]

337

351

-

Iprscan [seg]

355

363

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan [tmhmm]

10

27

-

Iprscan [tmhmm]

79

98

-

Iprscan [tmhmm]

108

127

-

Iprscan [tmhmm]

139

158

-

Iprscan [tmhmm]

168

190

-

Iprscan [tmhmm]

211

233

-

Iprscan [tmhmm]

268

290

-

Iprscan [tmhmm]

303

322

-

Iprscan [tmhmm]

326

348

-

Iprscan [tmhmm]

355

377

-

Iprscan [tmhmm]

399

416

-

Iprscan [tmhmm]

423

445

-

PDA1I4B9

443

566

S=456 I=71 E=1.17453e-47

PD605865

154

274

S=370 I=59 E=2.78541e-37

PD572086

316

442

S=186 I=43 E=6.0462e-15

PDA1H2I1

27

64

S=170 I=79 E=5.3893e-13

PDA2P423

1

26

S=126 I=100 E=9.54175e-08

PDA271E7

443

553

S=109 I=30 E=1.20542e-05

PDA522Z5

1

26

S=104 I=85 E=4.53615e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one d8omQdUZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

72 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr36900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr36900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr36900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw1nmHZ/XFF4834R_chr36900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.