Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr08470lgtXFF4834R_chr08470Probable phosphatidylglycerol-prolipoprotein diacylglyceryl transferase
  2. XFF4834R_chr09530lolBXFF4834R_chr09530Probable outer-membrane lipoprotein LolB
  3. XFF4834R_chr14200XFF4834R_chr15130097_1628570_f3_XFF4834R-XFF4834R_chr14200XFF4834R_chr14200Putative secreted lipoprotein
  4. XFF4834R_chr21320XFF4834R_chr23230198_2474953_r3_XFF4834R-XFF4834R_chr21320XFF4834R_chr21320putative lipoprotein

lgt XFF4834R_chr08470
XFF4834R_chr08460
XFF4834R_chr08460
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08480
XFF4834R_chr08480
ID lgt
AC XFF4834R_chr08470
LT XFF4834R_chr08470
OR XFF4834R_chr from 984688 to 985578 on strand +
DE Probable phosphatidylglycerol-prolipoprotein diacylglyceryl transferase
IP Prolipoprotein diacylglyceryl transferase
CL 1.6.10 Lipoprotein GO:0042158
EC
GO InterPro
Biological Process: lipoprotein biosynthetic process (GO:0042158)
Biological Process: protein lipoylation (GO:0009249)
Cellular Component: membrane (GO:0016020)
transferring glycosyl groups (GO:0016757)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100820)
MW 32799.7 Da
SQ 296 aa
 
........10........20........30........40........50
| | | | |
MIYLHAIDPIAFSLGPVQVHWYGLMYLAAFFSAWALGRSRILRGRLPGVD
MDGFSDLLFYGMLGVVLGGRIGYMLFYAFETFLANPLILFKVWEGGMSFH
GGLLGVLIACWLWARKHRLHFFDVMDFVAPLVPLGLGFGRLGNFVGGELW
GKFTQAGWGVIFPHAPELADRLPAQIQAQYAAGALNQFARHPSQLYEAAL
EGVVMFVVLWTFSMKPRARYAVSGLFALLYGVFRFIVEFVRVPDAPIGYL
AFNWLTMGQILSLPLIAVGLVLLAMSRRAPVLQPVLPVIVGVEAAK
XFF4834R

NP_641193.1 lcl|lgt-XAC0841

1

296

S=1489 I=99 E=2.2602e-173

prolipoprotein diacylglyceryl transferase

XFF4834R

YP_362625.1 lcl|lgt-XCV0894

1

296

S=1486 I=99 E=4.61999e-173

prolipoprotein diacylglyceryl transferase

XFF4834R

NP_636177.1 lcl|lgt-XCC0786

1

296

S=1425 I=95 E=1.37785e-165

prolipoprotein diacylglyceryl transferase

XFF4834R

lcl|lgt-XALc_2769

1

290

S=1192 I=82 E=1.95824e-137

probable prolipoprotein diacylglyceryl transferase

pubmed

2

280

S=666 I=54 E=5.215e-72

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell inner membrane Transmembrane

Pubmed 19675025

 

prodomImg

pubmed

3

280

S=629 I=49 E=1.44153e-67

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell inner membrane Transmembrane

Pubmed 7896715

 

prodomImg

pubmed

3

280

S=629 I=50 E=1.54567e-67

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell inner membrane Transmembrane

Pubmed 8344935

 

prodomImg

pubmed

8

284

S=470 I=40 E=2.77648e-48

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell inner membrane Transmembrane

Pubmed 18700039

 

prodomImg

pubmed

6

272

S=463 I=40 E=2.09876e-47

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell membrane Transmembrane

Pubmed 18550617

 

prodomImg

sp_Pdown

sp|Q8PP47|LGT_XANAC

1

296

S=1489 I=99 E=6.34471e-172

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell inner membrane Transmembrane

sp_Pdown

sp|Q3BX88|LGT_XANC5

1

296

S=1486 I=99 E=1.2969e-171

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell inner membrane Transmembrane

sp_Pdown

sp|Q5GWB4|LGT_XANOR

1

296

S=1462 I=96 E=1.12521e-168

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell inner membrane Transmembrane

sp_Pdown

sp|B2SPS7|LGT_XANOP

1

296

S=1462 I=96 E=1.12521e-168

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell inner membrane Transmembrane

sp_Pdown

sp|Q2NZH8|LGT_XANOM

1

296

S=1462 I=96 E=1.12521e-168

Prolipoprotein diacylglyceryl transferase EC=2.4.99.- ; Cell inner membrane Transmembrane

Iprscan IPR001640 [MF_01147]

6

280

Prolipoprotein diacylglyceryl transferase

Iprscan IPR001640 [PF01790]

7

278

Prolipoprotein diacylglyceryl transferase

Iprscan IPR001640 [TIGR00544]

1

286

Prolipoprotein diacylglyceryl transferase

Iprscan IPR001640 [PS01311]

139

151

Prolipoprotein diacylglyceryl transferase

Iprscan [SignalP-NN(euk)]

1

39

-

Iprscan [tmhmm]

15

37

-

Iprscan [tmhmm]

57

79

-

Iprscan [tmhmm]

92

114

-

Iprscan [tmhmm]

220

237

-

Iprscan [tmhmm]

252

274

-

PD285051

7

125

S=279 I=49 E=2.41793e-26

PD005412

126

245

S=224 I=48 E=1.29439e-19

PD888888

116

192

S=200 I=52 E=1.07513e-16

PDA1K954

249

287

S=133 I=72 E=1.46175e-08

PDA5N1D0

243

281

S=114 I=51 E=2.98291e-06

PD830995

64

197

S=113 I=27 E=3.31191e-06

PDA5N1C5

243

273

S=106 I=61 E=2.77962e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1sEzKBN0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

28 hits
swiss-prot

Swiss-Prot ncbi-blastp

524 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr08470.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr08470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr08470.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr08470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
lolB XFF4834R_chr09530
XFF4834R_chr09520
XFF4834R_chr09520
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09540
XFF4834R_chr09540
ID lolB
AC XFF4834R_chr09530
LT XFF4834R_chr09530
OR XFF4834R_chr from 1095304 to 1095957 on strand +
DE Probable outer-membrane lipoprotein LolB
IP Outer membrane lipoprotein LolB
CL 1.6.10 Lipoprotein GO:0042158
EC
GO InterPro
Biological Process: protein transport (GO:0015031)
Cellular Component: cell outer membrane (GO:0009279)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100820)
MW 23300 Da
SQ 217 aa
 
........10........20........30........40........50
| | | | |
MSKTVRTLALGGLVLVGLSACVSVPRGQGSGAAVVDHVSDSARQAEAARQ
AWLQAHPHWSFQGRVAISKDRNGGSSRIDWQQDGPRYRVQLSAPVTRQSW
VLTGDTTSGAGRLEGLDGGPRSGPDAEQVLLEATGWTIPVNQMPDWVRAL
RIADAGAARVDLDVAGRPRTVQQDGWTIDFLAWTPASAEQPALPQRIEAR
NGEAKVRLLVDQWTVSP
Show or not Domain decomposition
 
XFF4834R

NP_641299.1 lcl|lolB-XAC0947

1

217

S=921 I=89 E=9.52126e-105

outer membrane lipoprotein LolB

XFF4834R

YP_362709.1 lcl|lolB-XCV0978

1

217

S=899 I=87 E=4.07676e-102

outer membrane lipoprotein LolB

XFF4834R

NP_636261.1 lcl|lolB-XCC0870

1

217

S=858 I=79 E=4.09533e-97

outer membrane lipoprotein LolB

XFF4834R

lcl|lolB-XALc_0489

32

215

S=564 I=64 E=1.73586e-61

probable outer-membrane lipoprotein lolb precursor

pubmed

50

214

S=422 I=55 E=1.12893e-42

LolB

Pubmed 19218412

 

prodomImg

pubmed

59

213

S=174 I=32 E=1.04488e-12

Outer-membrane lipoprotein lolB ; Cell Chaperone Palmitate transport Signal

Pubmed 7883699

 

prodomImg

pubmed

58

216

S=140 I=28 E=1.54173e-08

Outer-membrane lipoprotein lolB ; Cell Chaperone Palmitate transport Signal

Pubmed 7679718

 

prodomImg

pubmed

58

216

S=136 I=28 E=4.35115e-08

Outer-membrane lipoprotein lolB ; Cell Chaperone Palmitate transport Signal

Pubmed 1427085,7679718

 

prodomImg

sp_Pdown

sp|Q5GWR2|LOLB_XANOR

1

217

S=927 I=84 E=4.52855e-104

Outer-membrane lipoprotein lolB ; Cell Chaperone Palmitate transport Signal

sp_Pdown

sp|B2SQN8|LOLB_XANOP

1

217

S=927 I=84 E=4.52855e-104

Outer-membrane lipoprotein lolB ; Cell Chaperone Palmitate transport Signal

sp_Pdown

sp|Q2NZW5|LOLB_XANOM

1

217

S=927 I=84 E=4.52855e-104

Outer-membrane lipoprotein lolB ; Cell Chaperone Palmitate transport Signal

sp_Pdown

sp|Q8PNU2|LOLB_XANAC

1

217

S=921 I=89 E=2.545e-103

Outer-membrane lipoprotein lolB ; Cell Chaperone Palmitate transport Signal

sp_Pdown

sp|Q3BX04|LOLB_XANC5

1

217

S=899 I=87 E=1.0897e-100

Outer-membrane lipoprotein lolB ; Cell Chaperone Palmitate transport Signal

Iprscan [MF_00233]

4

215

-

Iprscan IPR004565 [PF03550]

56

213

Outer membrane lipoprotein LolB

Iprscan IPR004565 [TIGR00548]

4

215

Outer membrane lipoprotein LolB

Iprscan [PS51257]

1

21

-

Iprscan [seg]

8

24

-

Iprscan [SignalP-NN(euk)]

1

21

-

PDA0Q7C2

39

212

S=217 I=34 E=7.70163e-19

PDA1F2K6

169

217

S=157 I=59 E=1.64914e-11

PD013455

75

216

S=128 I=26 E=4.76565e-08

PDA8G6Z8

156

213

S=108 I=38 E=1.11808e-05

Iprscan [SSF89392]

20

216

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gg8mygsh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

140 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr09530.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr09530.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr09530.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr09530.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr15130097_1628570_f3_XFF4834R-XFF4834R_chr14200 XFF4834R_chr14200
XFF4834R_chr_1527
XFF4834R_chr_1527
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4646
XFF4834R_chr_4646
ID XFF4834R_chr15130097_1628570_f3_XFF4834R-XFF4834R_chr14200
AC XFF4834R_chr14200
LT XFF4834R_chr14200
OR XFF4834R_chr from 1628097 to 1628570 on strand +
DE Putative secreted lipoprotein
IP Protein of unknown function DUF3574
CL 1.6.10 Lipoprotein GO:0042158
EC
GO InterPro


Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100831)
MW 17305.5 Da
SQ 157 aa
 
........10........20........30........40........50
| | | | |
MKLLPSCLLAAMLALTACATTPGVTPPATTASLQGDAARPAAARGWVRSE
LYFGVGEESGPADRPQTRTIDETQWRAFLDKEVTPRFPDGLTVFDAYGQW
LFRGAKEPNRLGTKVLVILHEDTPQRRNDIEAIRLAWKQATGHQSVLWSR
QAVEVSF
XFF4834R

YP_365063.1 XCV3332

1

157

S=664 I=83 E=8.20889e-74

putative secreted protein

XFF4834R

NP_638425.1 XCC3078

32

157

S=631 I=94 E=7.69712e-70

hypothetical protein

XFF4834R

XALc_0709 XALc_0709

32

157

S=606 I=90 E=8.3046e-67

conserved hypothetical protein.

Iprscan IPR021957 [PF12098]

47

157

Protein of unknown function DUF3574

Iprscan [PS51257]

1

18

-

Iprscan [seg]

7

31

-

Iprscan [SignalP-NN(euk)]

1

19

-

PD647790

34

157

S=320 I=52 E=3.03124e-31

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JAhBbUfI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr14200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr14200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr14200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr14200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr23230198_2474953_r3_XFF4834R-XFF4834R_chr21320 XFF4834R_chr21320
XFF4834R_chr21310
XFF4834R_chr21310
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2279
XFF4834R_chr_2279
ID XFF4834R_chr23230198_2474953_r3_XFF4834R-XFF4834R_chr21320
AC XFF4834R_chr21320
LT XFF4834R_chr21320
OR XFF4834R_chr from 2474198 to 2474953 on strand -
DE putative lipoprotein
IP Protein of unknown function DUF1264
CL 1.6.10 Lipoprotein GO:0042158
EC
GO InterPro


Curated
PM
AN blast avec protein de pseudomonas phaseolicola putaive lipoprotein (pubmed)
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by durand (20100615)
MW 27476.7 Da
SQ 251 aa
 
........10........20........30........40........50
| | | | |
MRHSALLIGVALCASCSRSPPSVTPPGAPESAKTNVLEAGAKVLQPSGPV
GKLDIYLVGFHPMKDAPDEQMEAHHYCQQVNEDLAQCALYDGNTDRANLT
GIEYIISETLFAQLPEHERSFWHPHNGEILSGQLSAPNLPQLAEKELMRS
KINSYGKTWHTWHSRKGTTPGDTLPLGEPMLAWSFNRDGELQQRLVAQRD
RAVSVSTAERRANRQDLVPLAKPQEGVDALRAHFSDAQPIPGVTDAKGSH
P
Show or not Domain decomposition
 
XFF4834R

YP_363811.1 lcl|XCV2080

1

251

S=1268 I=94 E=1.0517e-146

putative lipoprotein

XFF4834R

NP_642355.1 lcl|XAC2029-XAC2029

7

251

S=1261 I=96 E=6.39288e-146

hypothetical protein

XFF4834R

NP_637362.1 lcl|XCC1997

6

249

S=1085 I=80 E=1.401e-124

hypothetical protein

Iprscan IPR010686 [PF06884]

48

218

Protein of unknown function DUF1264

Iprscan [SignalP-NN(euk)]

1

19

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kyONgIiy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr21320.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr21320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr21320.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp3gYCR/XFF4834R_chr21320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.