Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr31250cfaXFF4834R_chr31250putative cyclopropane-fatty-acyl-phospholipid synthase
  2. XFF4834R_chr31280XFF4834R_chr33900554_3597624_f1_XFF4834R-XFF4834R_chr31280XFF4834R_chr31280putative cyclopropane-fatty-acyl-phospholipid synthase

cfa XFF4834R_chr31250
XFF4834R_chr31240
XFF4834R_chr31240
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31260
XFF4834R_chr31260
ID cfa
AC XFF4834R_chr31250
LT XFF4834R_chr31250
OR XFF4834R_chr from 3593920 to 3595215 on strand +
DE putative cyclopropane-fatty-acyl-phospholipid synthase
IP Cyclopropane-fatty-acyl-phospholipid synthase
CL 1.6.1.1 Cyclopropane fatty acid (CFA) biosynthesis
EC
GO InterPro
Biological Process: lipid biosynthetic process (GO:0008610)
Molecular Function: cyclopropane-fatty-acyl-phospholipid synthase activity (GO:0008825)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100809)
MW 48205.5 Da
SQ 431 aa
 
........10........20........30........40........50
| | | | |
MNATSLPDHAAPRAASWTDRLLRKRLLATLGQLRDGQLQLHEAGTVTTLG
TATGAQALQMQLRVIDPGFYRQAALNGSVGAGESYMDGQWQCDDLVALMR
LLLRNRERLDAMETGTARLGGWAMRSLHAFARNTRSGSRRNIAAHYDLGN
PLFKLFLDENLMYSSAIFVDGEEALGEAALERAATRKLERICQKLRLAPH
HHVVEIGTGWGGFALHAAREHGCRVTTTTISREQFELANQRIAAAGLSDR
VTVLLRDYRDLEGRFDRVVSIEMIEAIGHQYLDTYFAKVGSLLADDGEAL
IQAITIEDHRYKQALHSVDFIKRHIFPGSFIPSVAAMTGAIARASDLRLF
NLEDIGPSYALTLRAWRQRFMAQLPQVRALGYDERFIRMWEFYLAYCEAG
FLERSIGDVHLWLNKPDARPPQFVPGLTADA
XFF4834R

XFF4834R_chr31280 lcl|XFF4834R_chr33900554_3597624_f1_XFF4834R-XFF4834R_chr31280

145

333

S=165 I=31 E=2.22727e-13

XFF4834R

NP_641710.2 lcl|cfaA-XAC1375

1

431

S=2013 I=89 E=0

cyclopropane-fatty-acyl-phospholipid synthase

XFF4834R

YP_363162.1 lcl|cfa-XCV1431

1

431

S=2003 I=89 E=0

cyclopropane-fatty-acyl-phospholipid synthase

XFF4834R

NP_636703.2 lcl|cfaA-XCC1329

1

431

S=1868 I=83 E=0

cyclopropane-fatty-acyl-phospholipid synthase

XFF4834R

lcl|cfa-XALc_2498

19

431

S=1585 I=73 E=0

probable cyclopropane-fatty-acyl-phospholipid synthase protein

XFF4834R

lcl|XALc_2501

145

334

S=168 I=28 E=3.99318e-13

putative cyclopropane-fatty-acyl-phospholipid synthase protein

XFF4834R

YP_363159.1 lcl|cfa-XCV1428

145

333

S=166 I=31 E=6.73766e-13

putative cyclopropane-fatty-acyl-phospholipid synthase

XFF4834R

NP_641707.1 lcl|XAC1372-XAC1372

145

333

S=166 I=31 E=6.91621e-13

hypothetical protein

XFF4834R

NP_636700.1 lcl|XCC1326

145

333

S=150 I=29 E=6.55276e-11

hypothetical protein

pubmed

1

423

S=1419 I=68 E=4.50252e-163

Cylcopropane fatty acid acyl phospholipid synthase

Pubmed 19648381

 

prodomImg

pubmed

128

411

S=544 I=38 E=4.61569e-57

Cyclopropane synthase

Pubmed 11997456

 

prodomImg

pubmed

62

412

S=484 I=37 E=8.97964e-50

Cyclopropane-fatty-acyl-phospholipid synthase EC=2.1.1.79 ; Cytoplasm synthesis Methyltransferase S-adenosyl-L-methionine

Pubmed 1445840

 

prodomImg

pubmed

62

412

S=481 I=36 E=2.18515e-49

Cyclopropane fatty acid synthase Cyclopropane fatty acyl phospholipid synthase EC=2.1.1.79 ; Methyltransferase

Pubmed 15632439

 

prodomImg

pubmed

12

401

S=435 I=32 E=7.18489e-44

Putative cyclopropane fatty acid synthase

Pubmed 16322509

 

prodomImg

sp_Pdown

sp|P0A9H7|CFA_ECOLI

62

412

S=484 I=37 E=6.10872e-50

Cyclopropane-fatty-acyl-phospholipid synthase EC=2.1.1.79 ; Cytoplasm synthesis Methyltransferase S-adenosyl-L-methionine

sp_Pdown

sp|P0A9H8|CFA_ECOL6

62

412

S=484 I=37 E=6.10872e-50

Cyclopropane-fatty-acyl-phospholipid synthase EC=2.1.1.79 ; Cytoplasm synthesis Methyltransferase S-adenosyl-L-methionine

sp_Pdown

sp|P31049|YLP3_PSEPU

142

401

S=396 I=34 E=2.64389e-39

Uncharacterized methyltransferase in lpd-3 5'region EC=2.1.1.-

sp_Pdown

sp|P0C5C2|CFA1_MYCTU

141

401

S=254 I=30 E=4.47549e-22

Cyclopropane-fatty-acyl-phospholipid synthase 1 EC=2.1.1.79 ; Cytoplasm synthesis Methyltransferase S-adenosyl-L-methionine

sp_Pdown

sp|A5U866|CFA1_MYCTA

141

401

S=254 I=30 E=4.47549e-22

Cyclopropane-fatty-acyl-phospholipid synthase 1 EC=2.1.1.79 ; Cytoplasm synthesis Methyltransferase S-adenosyl-L-methionine

Iprscan [G3DSA:3.40.50.150]

131

415

-

Iprscan IPR003333 [PIRSF003085]

15

429

Cyclopropane-fatty-acyl-phospholipid synthase

Iprscan [PTHR10108]

102

355

-

Iprscan IPR003333 [PF02353]

138

406

Cyclopropane-fatty-acyl-phospholipid synthase

Iprscan [seg]

43

59

-

Iprscan [seg]

98

109

-

Iprscan [seg]

171

184

-

PD003506

141

415

S=452 I=40 E=3.2968e-47

PDA1G540

380

415

S=163 I=75 E=2.71304e-12

PD597951

1

32

S=161 I=100 E=5.26296e-12

PDA2F2K2

202

401

S=146 I=23 E=3.39766e-10

PD329110

62

140

S=142 I=45 E=9.26036e-10

PD074536

187

257

S=142 I=45 E=1.01925e-09

Iprscan [SSF53335]

134

415

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one bMEDgFqZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

33 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSaObDy/XFF4834R_chr31250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSaObDy/XFF4834R_chr31250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSaObDy/XFF4834R_chr31250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSaObDy/XFF4834R_chr31250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr33900554_3597624_f1_XFF4834R-XFF4834R_chr31280 XFF4834R_chr31280
XFF4834R_chr31270
XFF4834R_chr31270
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31290
XFF4834R_chr31290
ID XFF4834R_chr33900554_3597624_f1_XFF4834R-XFF4834R_chr31280
AC XFF4834R_chr31280
LT XFF4834R_chr31280
OR XFF4834R_chr from 3596554 to 3597624 on strand +
DE putative cyclopropane-fatty-acyl-phospholipid synthase
IP Cyclopropane-fatty-acyl-phospholipid synthase
CL 1.6.1.1 Cyclopropane fatty acid (CFA) biosynthesis
EC
GO InterPro
Biological Process: lipid biosynthetic process (GO:0008610)
Molecular Function: cyclopropane-fatty-acyl-phospholipid synthase activity (GO:0008825)

Curated
PM
AN is included in the S-adenosyl-L-methionine (SAM) -dependent methyltransferase family
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100827)
MW 40859.8 Da
SQ 356 aa
 
........10........20........30........40........50
| | | | |
MSTVTVPPSAQPEEAFATRLAESGVLPDAVLRHGIRRLCAQRLRDERGND
ADASGERQRAFIDSLRASAIAIETDAANRQHYELPPQFFTLCLGRRLKYS
SCYWDATTPNLDAAEERMLALYGERAELADGQRILELGCGWGSLTLWMAE
RYPNASITAVSNSRPQRAHILEQCRVRGLSNVQVITADVNALTLPPGDFD
RVVSVEMFEHMRNYRDLLARVGSWLAPGGKLFVHIFCHRDLAYPFEVAGE
DNWMGRHFFTGGLMPAADTLLHFQQDVVIEQRWVLSGEHYEKTANAWLEN
QDRHRDQIMPLLKQTYGDDAQRWWQRWRMFWLACAELFGYDQGREWGVAH
YRFVKR
XFF4834R

XFF4834R_chr31250 cfa-XFF4834R_chr31250

81

266

S=175 I=34 E=1.04299e-14

cyclopropane fatty acyl phospholipid synthase (unsaturated-phospholipid methyltransferase)

XFF4834R

XFF4834R_chr23880 ubiG-XFF4834R_chr23880

103

261

S=144 I=32 E=6.26923e-11

bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase

XFF4834R

NP_641707.1 XAC1372-XAC1372

1

356

S=1888 I=99 E=0

hypothetical protein

XFF4834R

YP_363159.1 cfa-XCV1428

1

356

S=1872 I=98 E=0

putative cyclopropane-fatty-acyl-phospholipid synthase

XFF4834R

NP_636700.1 XCC1326

1

356

S=1780 I=93 E=0

hypothetical protein

XFF4834R

XALc_2501 XALc_2501

1

356

S=1508 I=76 E=1.47645e-175

putative cyclopropane-fatty-acyl-phospholipid synthase protein

XFF4834R

YP_363162.1 cfa-XCV1431

81

266

S=183 I=34 E=4.57334e-15

cyclopropane-fatty-acyl-phospholipid synthase

XFF4834R

NP_641710.2 cfaA-XAC1375

81

266

S=177 I=34 E=2.63828e-14

cyclopropane-fatty-acyl-phospholipid synthase

XFF4834R

NP_636703.2 cfaA-XCC1329

81

266

S=168 I=32 E=2.85126e-13

cyclopropane-fatty-acyl-phospholipid synthase

XFF4834R

XALc_2498 cfa-XALc_2498

69

266

S=168 I=30 E=2.90141e-13

probable cyclopropane-fatty-acyl-phospholipid synthase protein

XFF4834R

YP_364305.1 ubiG-XCV2574

103

261

S=149 I=32 E=6.23874e-11

3-demethylubiquinone-9 3-methyltransferase

XFF4834R

NP_637624.1 ubiG-XCC2269

103

261

S=134 I=30 E=3.92362e-09

3-demethylubiquinone-9 3-methyltransferase

XFF4834R

NP_642693.1 ubiG-XAC2377

103

261

S=133 I=31 E=5.56092e-09

3-demethylubiquinone-9 3-methyltransferase

XFF4834R

XALc_1919 ubiG-XALc_1919

103

261

S=127 I=27 E=3.18015e-08

probable 3-demethylubiquinone-9 3-methyltransferase (3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase) (dhhb methyltransferase) protein

pubmed

2

355

S=1304 I=68 E=2.62931e-149

Putative uncharacterized protein

Pubmed 19648381

 

prodomImg

pubmed

26

356

S=641 I=38 E=6.25148e-69

(S)-coclaurine N-methyltransferase EC=2.1.1.140

Pubmed 15722473

 

prodomImg

pubmed

22

356

S=635 I=38 E=2.95108e-68

Coclaurine N-methyltransferase EC=2.1.1.115

Pubmed 11682473

 

prodomImg

pubmed

22

356

S=601 I=36 E=4.62837e-64

Putative N-methyltransferase

Pubmed 19624470

 

prodomImg

pubmed

22

356

S=569 I=34 E=3.312e-60

Pavine N-methyltransferase

Pubmed 19624470

 

prodomImg

sp_Pdown

acc=P0A9H7

79

299

S=265 I=30 E=1.50258e-23

Cyclopropane-fatty-acyl-phospholipid synthase EC=2.1.1.79 ; Cytoplasm synthesis Methyltransferase S-adenosyl-L-methionine

sp_Pdown

acc=P0A9H8

79

299

S=265 I=30 E=1.50258e-23

Cyclopropane-fatty-acyl-phospholipid synthase EC=2.1.1.79 ; Cytoplasm synthesis Methyltransferase S-adenosyl-L-methionine

sp_Pdown

acc=P31049

74

338

S=182 I=26 E=1.78948e-13

Uncharacterized methyltransferase in lpd-3 5'region EC=2.1.1.-

sp_Pdown

acc=Q49807

77

355

S=168 I=23 E=8.29446e-12

Cyclopropane-fatty-acyl-phospholipid synthase EC=2.1.1.79 ; Cytoplasm synthesis Methyltransferase S-adenosyl-L-methionine

sp_Pdown

acc=P0C5C2

77

338

S=162 I=25 E=5.04191e-11

Cyclopropane-fatty-acyl-phospholipid synthase 1 EC=2.1.1.79 ; Cytoplasm synthesis Methyltransferase S-adenosyl-L-methionine

Iprscan [G3DSA:3.40.50.150]

76

352

-

Iprscan [PTHR10108:SF26]

113

233

-

Iprscan [PTHR10108]

113

233

-

Iprscan IPR003333 [PF02353]

77

338

Cyclopropane-fatty-acyl-phospholipid synthase

PD003506

79

338

S=285 I=31 E=4.76009e-27

PD693283

19

80

S=255 I=82 E=1.89925e-23

PD499188

264

320

S=180 I=56 E=2.34412e-14

PD733820

211

262

S=150 I=48 E=1.15298e-10

PD353409

319

353

S=141 I=74 E=1.17228e-09

PD000198

124

245

S=124 I=30 E=1.49393e-07

Iprscan [SSF53335]

70

355

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1pm9KfLm)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

79 hits
swiss-prot

Swiss-Prot ncbi-blastp

79 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSaObDy/XFF4834R_chr31280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSaObDy/XFF4834R_chr31280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSaObDy/XFF4834R_chr31280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSaObDy/XFF4834R_chr31280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.