Xanthomonas fuscans subsp. fuscans

8 hits

  1. XFF4834R_chr02360XFF4834R_chr02490203_0280230_r1_XFF4834R-XFF4834R_chr02360XFF4834R_chr02360probable biotin carboxylase, acetyl-coa carboxylase subunit a protein
  2. XFF4834R_chr02370XFF4834R_chr02510471_0282081_r1_XFF4834R-XFF4834R_chr02370XFF4834R_chr02370probable acetyl-coenzyme a carboxyltransferase beta subunit protein
  3. XFF4834R_chr05280accCXFF4834R_chr05280 probable acetyl-CoA carboxylase, biotin carboxylase subunit
  4. XFF4834R_chr05300accBXFF4834R_chr05300probable acetyl CoA carboxylase, BCCP subunit
  5. XFF4834R_chr11170fabHXFF4834R_chr11170probable 3-oxoacyl-[acyl-carrier-protein] synthase III
  6. XFF4834R_chr11190fabDXFF4834R_chr11190probable malonyl-CoA-[acyl-carrier-protein] transacylase
  7. XFF4834R_chr27110accDXFF4834R_chr27110probable acetyl-CoA carboxylase, beta (carboxyltranferase) subunit
  8. XFF4834R_chr30920accAXFF4834R_chr30920probable acetyl-CoA carboxylase, carboxytransferase, alpha subunit

XFF4834R_chr02490203_0280230_r1_XFF4834R-XFF4834R_chr02360 XFF4834R_chr02360
XFF4834R_chr02350
XFF4834R_chr02350
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02370
XFF4834R_chr02370
ID XFF4834R_chr02490203_0280230_r1_XFF4834R-XFF4834R_chr02360
AC XFF4834R_chr02360
LT XFF4834R_chr02360
OR XFF4834R_chr from 278203 to 280230 on strand -
DE probable biotin carboxylase, acetyl-coa carboxylase subunit a protein
IP Pyruvate carboxylase; Glutathione synthetase, prokaryotic
CL 1.5.4.3 Fatty acid biosynthesis -- initial steps
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: biotin binding (GO:0009374)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: ligase activity (GO:0016874)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN homologie de 40 pourcent avec coli sur 400 aa un autre gene XFF4834R (0580) correspond mieux a accC donc ne pas suivre annotation de xav mais celle de albilineans
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110630)
MW 72310.1 Da
SQ 675 aa
 
........10........20........30........40........50
| | | | |
MTQRDPIAAATQAPFDKILIANRGEIACRVIATCRALGIATVAVYSDADR
SARHVRMADEAVHIGAAPAQQSYLRGEAILQAARATGAQAIHPGYGFLSE
NAAFAEACAHAGIVFIGPPAAAIRAMGDKSAAKALMQRAGVPLTPGYHGD
EQAPAFLRAQADAIGYPVLIKASAGGGGKGMRRVDASAAFDDALASCQRE
AQSAFGNAHVLVEKYVQRPRHIEIQVFGDTHGEVVYLFERDCSVQRRHQK
VLEEAPAPGMSEARRAAMGKAAVDAAQAVGYVGAGTVEFIAGPDGDFYFM
EMNTRLQVEHPVTELITGTDLVEWQLRVAAGARLPRRQHELRIHGHALEA
RLYAEDAERGFLPSTGTLRQLQMPAASAHVRVDAGVEQGDTISPYYDPMI
AKLIVWDTDRPAALARMRAALAQFHAVGVTTNSAFLSRLIATDSFASANL
DTALIEREHAVLFPEARSPDNAWWCLAAALIADALPAVAVDPADPHSPWQ
HTDGWRIGAHAAQRIILEANGERRQLAVRPDADGWQVTNADQTHTLRYHR
HETGLRVEMDGRQWRVQVLRDGATLTLIGATQRAVFRHHDALAEADQPTQ
EAGGLTAPMPGRIVSLPATVGQPVARGQALVVLEAMKMEHTLHAPSDGTV
QAYLVVEGDLVADGAALVEFVSASA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr05280 lcl|accC-XFF4834R_chr05280

15

460

S=959 I=47 E=2.31286e-109

acetyl-CoA carboxylase, biotin carboxylase subunit

XFF4834R

NP_640619.1 lcl|accC-XAC0263

1

675

S=3091 I=91 E=0

biotin carboxylase

XFF4834R

YP_362002.1 lcl|accC-XCV0271

1

675

S=3090 I=89 E=0

biotin carboxylase

XFF4834R

NP_635639.1 lcl|accC-XCC0244

1

675

S=2627 I=77 E=0

biotin carboxylase

XFF4834R

lcl|accC-XALc_0149

15

673

S=2069 I=66 E=0

probable biotin carboxylase, acetyl-coa carboxylase subunit a protein

XFF4834R

lcl|accC-XALc_0312

15

460

S=966 I=47 E=1.49995e-109

probable acetyl-coa carboxylase, biotin carboxylase subunit protein

XFF4834R

NP_635907.1 lcl|accC-XCC0515

15

460

S=966 I=47 E=1.49995e-109

acetyl-CoA carboxylase biotin carboxylase subunit

XFF4834R

YP_362294.1 lcl|accC-XCV0563

15

460

S=961 I=47 E=5.35681e-109

acetyl-CoA carboxylase biotin carboxylase subunit

XFF4834R

NP_640883.1 lcl|accC-XAC0530

15

460

S=960 I=47 E=8.06997e-109

acetyl-CoA carboxylase biotin carboxylase subunit

XFF4834R

NP_644620.1 lcl|uahA-XAC4326

15

457

S=955 I=46 E=2.64142e-108

urea amidolyase

Iprscan IPR013817 [G3DSA:3.40.50.20]

14

98

Pre-ATP-grasp fold

Iprscan IPR013816 [G3DSA:3.30.470.20]

99

464

ATP-grasp fold, subdomain 2

Iprscan [G3DSA:2.40.50.100]

595

670

-

Iprscan [PTHR18866]

17

670

-

Iprscan IPR005479 [PF02786]

128

335

Carbamoyl phosphate synthetase, large subunit, ATP-binding

Iprscan IPR005481 [PF00289]

15

123

Carbamoyl phosphate synthase, large subunit, N-terminal

Iprscan IPR005482 [PF02785]

349

456

Biotin carboxylase, C-terminal

Iprscan IPR000089 [PF00364]

605

669

Biotin/lipoyl attachment

Iprscan IPR005482 [SM00878]

349

456

Biotin carboxylase, C-terminal

Iprscan IPR001882 [PS00188]

627

644

Biotin-binding site

Iprscan IPR005479 [PS00866]

166

180

Carbamoyl phosphate synthetase, large subunit, ATP-binding

Iprscan IPR005479 [PS00867]

299

306

Carbamoyl phosphate synthetase, large subunit, ATP-binding

Iprscan IPR000089 [PS50968]

603

670

Biotin/lipoyl attachment

Iprscan IPR011761 [PS50975]

133

330

ATP-grasp fold

Iprscan IPR011764 [PS50979]

14

460

Biotin carboxylation domain

Iprscan [seg]

102

111

-

Iprscan [seg]

185

196

-

Iprscan [seg]

412

422

-

Iprscan [seg]

476

495

-

Iprscan [SSF56059]

129

342

-

Iprscan IPR016185 [SSF52440]

14

128

PreATP-grasp-like fold

Iprscan IPR011054 [SSF51246]

343

466

Rudiment single hybrid motif

Iprscan IPR011053 [SSF51230]

588

671

Single hybrid motif

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vZJuse2f)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

263 hits
swiss-prot

Swiss-Prot ncbi-blastp

93 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

23 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr02360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr02360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr02360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr02360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr02510471_0282081_r1_XFF4834R-XFF4834R_chr02370 XFF4834R_chr02370
XFF4834R_chr02360
XFF4834R_chr02360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02380
XFF4834R_chr02380
ID XFF4834R_chr02510471_0282081_r1_XFF4834R-XFF4834R_chr02370
AC XFF4834R_chr02370
LT XFF4834R_chr02370
OR XFF4834R_chr from 280471 to 282081 on strand -
DE probable acetyl-coenzyme a carboxyltransferase beta subunit protein
IP Carboxyl transferase
CL 1.5.4.3 Fatty acid biosynthesis -- initial steps
EC
GO InterPro
Molecular Function: ligase activity (GO:0016874)

Curated
PM
AN pas assez d homology avec coli pour nommer le gene comme xav meme probleme que pour XFF4834R 0265
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100622)
MW 57309.9 Da
SQ 536 aa
 
........10........20........30........40........50
| | | | |
MSVIDSQLQVSGETFQHNAAAMRAVIDDLRRTLAQTARGGSDAARAKHTA
RGKLLARERIDALLDPGSALLEIAPLAAHGMYDDQVPCAGVVAGIGRVSG
VECVIVANDATVKGGTYYPVTVKKHLRAQEIAQQNRLPCIYLVDSGGAFL
PLQDEVFPDRDHFGRIFYNQATLSAQGIPQIACVMGSCTAGGAYVPAMSD
EAVIVREQGTIFLGGPPLVKAATGEEVSAEDLGGADVHTRISGVADHFAD
NDLQALARVRAIIAQLNWRKPAASLALQAPLPPRYAADELYGVIPADTRK
PFDVREVIARIVDDSRLDEFKPRYGSTLVTGFAHLHGYPVGIIANNGILF
SESALKGAHFIELCTQRGIPLVFLQNITGFMVGRKYEHGGIAKDGAKLVM
AVACAKVPKFTVVIGGSFGAGNYGMCGRAYSPNFLWMWPNARIGVMGGEQ
AASVLATVRRDGIEAKGGTWSGEDEDAFKAPIRAQFEQQGHPYYASARLW
DDGIIDPADTRRVLGLGLSAALNAPIEPTRFGVFRM
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr05580 lcl|XFF4834R_chr05800234_0636154_f2_XFF4834R-XFF4834R_chr05580

56

231

S=118 I=32 E=1.55949e-07

XFF4834R

XFF4834R_chr30920 lcl|accA-XFF4834R_chr30920

22

216

S=106 I=28 E=4.13722e-06

acetyl-CoA carboxylase, carboxytransferase, alpha subunit

XFF4834R

NP_640620.1 lcl|accD-XAC0264

1

536

S=2713 I=96 E=0

acyl-CoA carboxyltransferase beta chain

XFF4834R

YP_362003.1 lcl|accD-XCV0272

1

536

S=2703 I=96 E=0

acetyl-CoA carboxylase beta chain

XFF4834R

NP_635640.1 lcl|accD-XCC0245

1

536

S=2639 I=93 E=0

acyl-CoA carboxyltransferase beta chain

XFF4834R

lcl|accD-XALc_0150

1

536

S=2416 I=86 E=0

probable acetyl-coenzyme a carboxyltransferase beta subunit protein

XFF4834R

NP_640915.1 lcl|mdcB-XAC0562

56

231

S=116 I=30 E=9.77475e-07

malonate decarboxylase subunit beta

XFF4834R

NP_638957.1 lcl|mdcB-XCC3611

56

231

S=114 I=31 E=1.70782e-06

malonate decarboxylase subunit beta

XFF4834R

YP_363193.1 lcl|accA-XCV1462

22

216

S=110 I=29 E=4.69544e-06

acetyl-CoA carboxylase carboxyltransferase subunit alpha

XFF4834R

YP_362327.1 lcl|mdcD-XCV0596

56

231

S=110 I=30 E=5.30503e-06

malonate decarboxylase subunit beta

XFF4834R

NP_636731.1 lcl|accA-XCC1357

20

216

S=107 I=28 E=1.4209e-05

acetyl-CoA carboxylase carboxyltransferase subunit alpha

XFF4834R

NP_641740.1 lcl|accA-XAC1405

22

216

S=105 I=28 E=2.01383e-05

acetyl-CoA carboxylase carboxyltransferase subunit alpha

Iprscan [G3DSA:3.90.226.10]

11

272

-

Iprscan [G3DSA:3.90.226.10]

270

525

-

Iprscan [PTHR22855:SF13]

52

536

-

Iprscan [PTHR22855]

52

536

-

Iprscan IPR000022 [PF01039]

48

526

Carboxyl transferase

Iprscan IPR011762 [PS50980]

28

242

Acetyl-coenzyme A carboxyltransferase, N-terminal

Iprscan IPR011763 [PS50989]

243

530

Acetyl-coenzyme A carboxyltransferase, C-terminal

Iprscan [seg]

271

283

-

Iprscan [SSF52096]

2

531

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JncE3CYH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

50 hits
swiss-prot

Swiss-Prot ncbi-blastp

21 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr02370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr02370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr02370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr02370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
accC XFF4834R_chr05280
XFF4834R_chr05270
XFF4834R_chr05270
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr05290
XFF4834R_chr05290
ID accC
AC XFF4834R_chr05280
LT XFF4834R_chr05280
OR XFF4834R_chr from 593257 to 594624 on strand -
DE probable acetyl-CoA carboxylase, biotin carboxylase subunit
IP Acetyl-CoA carboxylase, biotin carboxylase; Glutathione synthetase, prokaryotic
CL 1.5.4.3 Fatty acid biosynthesis -- initial steps
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: biotin binding (GO:0009374)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: ligase activity (GO:0016874)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN Transcription of the biotin (bio) biosynthetic operon of Escherichia coli is negatively regulated by the BirA protein, an atypical repressor protein in that it is also an enzyme. The BirA-catalyzed reaction involves the covalent attachment of biotin to AccB, a subunit of acetyl coenzyme (acetyl-CoA) carboxylase. The two functions of BirA allow regulation of the bio operon to respond to the intracellular concentrations of both biotin and unbiotinylated AccB. We report here that bio operon expression is down-regulated by overproduction of AccC, another acetyl-CoA carboxylase subunit known to form a complex with AccB. This down-regulation is eliminated when AccB and AccC are coordinately overexpressed, but only when the AccB partner is competent to bind AccC. Under AccC overexpression conditions AccB is underbiotinylated. PMID: 17056747
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100722)
MW 49407.4 Da
SQ 455 aa
 
........10........20........30........40........50
| | | | |
MLDKVVIANRGEIALRILRACHTLGIRTVAVHSTVDRNLKHVAMADESVC
IGPAASSDSYLNIPALIAAAEVTDAQAIHPGYGFLSENADFAERVEQSGF
IFIGPKADTIRLMGDKVEAIRAMKAAGVPCVPGSGGPLGDDIVANTKVAR
EIGYPVIIKAAGGGGGRGMRVVHSEAALKAAIETTKSEAKAAFSNDQVYM
EKFLENPRHVEIQVLADGQGGAIHLGERDCSMQRRHQKVVEEAPAPGITE
ELRNEIGKVCVDACIRIGYRGAGTFEFLFENGRFYFIEMNTRIQVEHPVT
ERITGIDLVCEQLRIAAGHKLSIKQSDIVLRGHAIECRINAEDPETFMPN
PGLITAFHPPGGPGVRVDTHIYAGYKVPPNYDSMIGKLIVHGPDRETAIA
RMRVALSEMVVDGIKTNIPLQQRIMRDKGFQAGGQNIHYLEKRLAERKNK
SIALT
XFF4834R

XFF4834R_chr02360 lcl|XFF4834R_chr02490203_0280230_r1_XFF4834R-XFF4834R_chr02360

2

445

S=985 I=49 E=1.18791e-112

XFF4834R

XFF4834R_chr20080 lcl|carB-XFF4834R_chr20080

91

322

S=103 I=22 E=8.73602e-06

carbamoyl-phosphate synthase large subunit

XFF4834R

XFF4834R_chr07850 lcl|ddlB-XFF4834R_chr07850

149

291

S=98 I=25 E=3.01299e-05

D-alanine:D-alanine ligase

XFF4834R

YP_362294.1 lcl|accC-XCV0563

1

455

S=2353 I=98 E=0

acetyl-CoA carboxylase biotin carboxylase subunit

XFF4834R

NP_640883.1 lcl|accC-XAC0530

1

455

S=2352 I=98 E=0

acetyl-CoA carboxylase biotin carboxylase subunit

XFF4834R

NP_635907.1 lcl|accC-XCC0515

1

455

S=2325 I=97 E=0

acetyl-CoA carboxylase biotin carboxylase subunit

XFF4834R

lcl|accC-XALc_0312

1

455

S=2325 I=96 E=0

probable acetyl-coa carboxylase, biotin carboxylase subunit protein

XFF4834R

NP_635639.1 lcl|accC-XCC0244

2

445

S=1021 I=49 E=1.72051e-116

biotin carboxylase

XFF4834R

YP_362002.1 lcl|accC-XCV0271

2

445

S=997 I=49 E=1.57291e-113

biotin carboxylase

XFF4834R

lcl|accC-XALc_0149

2

445

S=981 I=48 E=1.25179e-111

probable biotin carboxylase, acetyl-coa carboxylase subunit a protein

XFF4834R

NP_640619.1 lcl|accC-XAC0263

2

445

S=967 I=49 E=6.1138e-110

biotin carboxylase

XFF4834R

NP_644620.1 lcl|uahA-XAC4326

1

442

S=820 I=40 E=3.82723e-92

urea amidolyase

XFF4834R

NP_637208.1 lcl|carB-XCC1843

91

223

S=108 I=25 E=8.74389e-06

carbamoyl phosphate synthase large subunit

XFF4834R

YP_363640.1 lcl|carB-XCV1909

91

322

S=103 I=22 E=3.15008e-05

carbamoyl phosphate synthase large subunit

XFF4834R

NP_642188.2 lcl|carB-XAC1862

91

322

S=103 I=22 E=3.40722e-05

carbamoyl phosphate synthase large subunit

XFF4834R

lcl|carB-XALc_1339

91

322

S=101 I=21 E=5.26896e-05

probable carbamoyl-phosphate synthetase large chain protein

pubmed

1

444

S=1753 I=75 E=0

Acetyl-CoA carboxylase

Pubmed 20088879

 

prodomImg

pubmed

1

444

S=1753 I=75 E=0

Biotin carboxylase EC=6.3.4.14 EC=6.4.1.2 ; ATP-binding Fatty acid biosynthesis Ligase Lipid Nucleotide-binding

Pubmed 1682920,1370469

 

prodomImg

pubmed

1

444

S=1713 I=73 E=0

Biotin carboxylase EC=6.3.4.14 EC=6.4.1.2 ; ATP-binding Fatty acid biosynthesis Ligase Lipid Nucleotide-binding

Pubmed 9560425

 

prodomImg

pubmed

1

449

S=1675 I=68 E=0

Biotin carboxylase EC=6.3.4.14 EC=6.4.1.2 ; ATP-binding Fatty acid biosynthesis Ligase Lipid Nucleotide-binding

Pubmed 7693652

 

prodomImg

pubmed

1

444

S=1385 I=58 E=5.72858e-159

Predicted acetyl-CoA carboxylase ; Manganese Metal-binding

Pubmed 16008504

 

prodomImg

sp_Pdown

sp|P24182|ACCC_ECOLI

1

444

S=1753 I=75 E=0

Biotin carboxylase EC=6.3.4.14 EC=6.4.1.2 ; ATP-binding Fatty acid biosynthesis Ligase Lipid Nucleotide-binding

sp_Pdown

sp|Q8X9B6|ACCC_ECO57

1

444

S=1750 I=74 E=0

Biotin carboxylase EC=6.3.4.14 EC=6.4.1.2 ; ATP-binding Fatty acid biosynthesis Ligase Lipid Nucleotide-binding

sp_Pdown

sp|P43873|ACCC_HAEIN

1

444

S=1730 I=73 E=0

Biotin carboxylase EC=6.3.4.14 EC=6.4.1.2 ; ATP-binding Fatty acid biosynthesis Ligase Lipid Nucleotide-binding

sp_Pdown

sp|O52058|ACCC_ALLVD

1

444

S=1713 I=73 E=0

Biotin carboxylase EC=6.3.4.14 EC=6.4.1.2 ; ATP-binding Fatty acid biosynthesis Ligase Lipid Nucleotide-binding

sp_Pdown

sp|P37798|ACCC_PSEAE

1

449

S=1675 I=68 E=0

Biotin carboxylase EC=6.3.4.14 EC=6.4.1.2 ; ATP-binding Fatty acid biosynthesis Ligase Lipid Nucleotide-binding

Iprscan IPR013817 [G3DSA:3.40.50.20]

1

85

Pre-ATP-grasp fold

Iprscan IPR013816 [G3DSA:3.30.470.20]

86

449

ATP-grasp fold, subdomain 2

Iprscan [PTHR18866]

4

446

-

Iprscan IPR005479 [PF02786]

115

323

Carbamoyl phosphate synthetase, large subunit, ATP-binding

Iprscan IPR005481 [PF00289]

1

110

Carbamoyl phosphate synthase, large subunit, N-terminal

Iprscan IPR005482 [PF02785]

336

441

Biotin carboxylase, C-terminal

Iprscan IPR005482 [SM00878]

336

441

Biotin carboxylase, C-terminal

Iprscan IPR004549 [TIGR00514]

1

448

Acetyl-CoA carboxylase, biotin carboxylase

Iprscan IPR005479 [PS00866]

154

168

Carbamoyl phosphate synthetase, large subunit, ATP-binding

Iprscan IPR005479 [PS00867]

286

293

Carbamoyl phosphate synthetase, large subunit, ATP-binding

Iprscan IPR011761 [PS50975]

120

317

ATP-grasp fold

Iprscan IPR011764 [PS50979]

1

445

Biotin carboxylation domain

Iprscan [seg]

162

168

-

PD866077

280

383

S=365 I=68 E=1.02115e-36

PD000820

1

78

S=238 I=60 E=2.34931e-21

PDA1F6J0

225

285

S=196 I=62 E=3.55533e-16

PD816161

169

226

S=177 I=59 E=6.88539e-14

PD584323

79

116

S=153 I=71 E=5.06189e-11

PDA1F789

354

383

S=145 I=73 E=4.75822e-10

PD002908

384

442

S=143 I=49 E=9.64166e-10

PDA879U1

345

383

S=133 I=62 E=1.43869e-08

PDA21196

349

383

S=114 I=60 E=2.86007e-06

PDA38400

347

383

S=113 I=49 E=3.78046e-06

Iprscan [SSF56059]

115

330

-

Iprscan IPR016185 [SSF52440]

1

115

PreATP-grasp-like fold

Iprscan IPR011054 [SSF51246]

330

451

Rudiment single hybrid motif

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Gf2H9BRo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

279 hits
swiss-prot

Swiss-Prot ncbi-blastp

128 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr05280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr05280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr05280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr05280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
accB XFF4834R_chr05300
XFF4834R_chr05290
XFF4834R_chr05290
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0583
XFF4834R_chr_0583
ID accB
AC XFF4834R_chr05300
LT XFF4834R_chr05300
OR XFF4834R_chr from 595074 to 595565 on strand -
DE probable acetyl CoA carboxylase, BCCP subunit
IP Biotin/lipoyl attachment; Acetyl-CoA biotin carboxyl carrier
CL 1.5.4.3 Fatty acid biosynthesis -- initial steps
EC
GO InterPro
Biological Process: fatty acid biosynthetic process (GO:0006633)
Cellular Component: acetyl-CoA carboxylase complex (GO:0009317)
Molecular Function: biotin binding (GO:0009374)
Molecular Function: acetyl-CoA carboxylase activity (GO:0003989)

Curated
PM
AN voir commentaire XFF4834R 0580 (accC)
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100722)
MW 17037.5 Da
SQ 163 aa
 
........10........20........30........40........50
| | | | |
MDLRKIKKLIDLLEESNLAEIEIKEGEESVRLARVPKGAAMLGAPVQQQY
APAPAAQAPAAAATMPMQSPTEASTGGAKQAAALPEGHVLRAPMVGTFYT
SPSPDKPAFVTVGQQVKVGDTLAIIEAMKMFNPIEADASGTIVAILGETG
QPVEFDQPLFVIG
Show or not Domain decomposition
 
XFF4834R

NP_640885.1 lcl|bccP-XAC0532

14

163

S=635 I=86 E=2.39414e-70

acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

XFF4834R

YP_362296.1 lcl|accB-XCV0565

14

163

S=627 I=86 E=2.67924e-69

acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

XFF4834R

NP_635909.1 lcl|bccP-XCC0517

14

163

S=579 I=79 E=1.69409e-63

acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

XFF4834R

lcl|accB-XALc_0313

14

163

S=523 I=74 E=1.13764e-56

probable biotin carboxyl carrier protein of acetyl-coa carboxylase (bccp)

XFF4834R

NP_644620.1 lcl|uahA-XAC4326

109

162

S=104 I=44 E=5.57119e-06

urea amidolyase

pubmed

14

162

S=335 I=50 E=2.39522e-32

Biotin carboxyl carrier protein of acetyl-CoA carboxylase ; Fatty acid biosynthesis Lipid

Pubmed 2660106,2575489

 

prodomImg

pubmed

87

162

S=272 I=66 E=1.05755e-24

Biotin carboxyl carrier protein of acetyl-CoA carboxylase ; Fatty acid biosynthesis Lipid

Pubmed 10675023

 

prodomImg

pubmed

87

162

S=268 I=67 E=2.73545e-24

Biotin carboxyl carrier protein of acetyl-CoA carboxylase ; Fatty acid biosynthesis Lipid

Pubmed 7693652

 

prodomImg

pubmed

64

162

S=247 I=54 E=1.0549e-21

Pyruvate carboxylase biotin-containing subunit

Pubmed 16352836

 

prodomImg

pubmed

14

163

S=239 I=40 E=9.49317e-21

Predicted biotin carboxyl carrier protein

Pubmed 10988064

 

prodomImg

sp_Pdown

sp|P0ABE1|BCCP_SHIFL

14

162

S=335 I=50 E=1.65127e-32

Biotin carboxyl carrier protein of acetyl-CoA carboxylase ; Fatty acid biosynthesis Lipid

sp_Pdown

sp|P0ABD8|BCCP_ECOLI

14

162

S=335 I=50 E=1.65127e-32

Biotin carboxyl carrier protein of acetyl-CoA carboxylase ; Fatty acid biosynthesis Lipid

sp_Pdown

sp|P0ABD9|BCCP_ECOL6

14

162

S=335 I=50 E=1.65127e-32

Biotin carboxyl carrier protein of acetyl-CoA carboxylase ; Fatty acid biosynthesis Lipid

sp_Pdown

sp|P0ABE0|BCCP_ECO57

14

162

S=335 I=50 E=1.65127e-32

Biotin carboxyl carrier protein of acetyl-CoA carboxylase ; Fatty acid biosynthesis Lipid

sp_Pdown

sp|P43874|BCCP_HAEIN

87

162

S=272 I=66 E=7.29072e-25

Biotin carboxyl carrier protein of acetyl-CoA carboxylase ; Fatty acid biosynthesis Lipid

Iprscan IPR001249 [PR01071]

92

105

Acetyl-CoA biotin carboxyl carrier

Iprscan IPR001249 [PR01071]

109

123

Acetyl-CoA biotin carboxyl carrier

Iprscan IPR001249 [PR01071]

124

137

Acetyl-CoA biotin carboxyl carrier

Iprscan [G3DSA:2.40.50.100]

84

163

-

Iprscan [PTHR18866:SF1]

110

162

-

Iprscan [PTHR18866]

110

162

-

Iprscan IPR000089 [PF00364]

89

162

Biotin/lipoyl attachment

Iprscan IPR001249 [TIGR00531]

1

163

Acetyl-CoA biotin carboxyl carrier

Iprscan IPR001882 [PS00188]

119

136

Biotin-binding site

Iprscan IPR000089 [PS50968]

88

162

Biotin/lipoyl attachment

Iprscan [seg]

2

13

-

Iprscan [seg]

44

63

-

PD150179

94

162

S=147 I=55 E=2.51807e-10

PDA6O983

35

85

S=120 I=59 E=4.09283e-07

PDA1Z511

35

85

S=105 I=55 E=2.9082e-05

Iprscan IPR011053 [SSF51230]

84

163

Single hybrid motif

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0bkub0k4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

28 hits
swiss-prot

Swiss-Prot ncbi-blastp

18 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr05300.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr05300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr05300.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr05300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
fabH XFF4834R_chr11170
XFF4834R_chr11160
XFF4834R_chr11160
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1198
XFF4834R_chr_1198
ID fabH
AC XFF4834R_chr11170
LT XFF4834R_chr11170
OR XFF4834R_chr from 1247972 to 1248949 on strand +
DE probable 3-oxoacyl-[acyl-carrier-protein] synthase III
IP Beta-ketoacyl-acyl carrier protein synthase III (FabH)
CL 1.5.4.3 Fatty acid biosynthesis -- initial steps
EC
GO InterPro
Biological Process: lipid biosynthetic process (GO:0008610)
Biological Process: fatty acid biosynthetic process (GO:0006633)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: 3-oxoacyl-[acyl-carrier-protein] synthase activity (GO:0004315)
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 34757.2 Da
SQ 325 aa
 
........10........20........30........40........50
| | | | |
MSKRIYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIVA
DDQTTSDLAYFASLKAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQA
RLGNIGCGAMDVNAACSGFVYALSVADKFVRSGDAKTVLVVGAETLTRIV
DWTDRTTCVLFGDGAGAVVLKADEETGILSTHLHADGSKKELLWDPVGVS
VGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLAASGYDKHDLDWLI
PHQANLRIIEATAKRLELPMEQVVVTVDRHGNTSSASVPLALDEAVRSGR
VQRGQLLLLEAFGGGFTWGSALLRY
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr26080 lcl|XFF4834R_chr28570060_3014139_r1_XFF4834R-XFF4834R_chr26080

8

325

S=289 I=30 E=1.50662e-28

XFF4834R

XFF4834R_chr02040 lcl|XFF4834R_chr02140693_0241709_f3_XFF4834R-XFF4834R_chr02040

42

321

S=162 I=26 E=4.50247e-13

XFF4834R

NP_641460.1 lcl|fabH-XAC1123

1

325

S=1693 I=99 E=0

3-oxoacyl-(acyl carrier protein) synthase III

XFF4834R

YP_362874.1 lcl|fabH-XCV1143

1

325

S=1689 I=99 E=0

3-oxoacyl-(acyl carrier protein) synthase III

XFF4834R

NP_636392.1 lcl|fabH-XCC1016

1

325

S=1587 I=97 E=0

3-oxoacyl-(acyl carrier protein) synthase III

XFF4834R

lcl|fabH-XALc_0624

1

325

S=1379 I=80 E=5.31447e-160

probable 3-oxoacyl-(acyl-carrier-protein) synthase 3

XFF4834R

NP_637793.2 lcl|fabH-XCC2440

8

325

S=351 I=32 E=1.80317e-35

GumO

XFF4834R

YP_363742.1 lcl|fabH-XCV2011

8

323

S=320 I=29 E=9.93353e-32

3-oxoacyl-[acyl-carrier protein] synthase III

XFF4834R

NP_642290.1 lcl|fabH-XAC1964

16

323

S=317 I=30 E=2.27416e-31

3-oxoacyl-[ACP] synthase

XFF4834R

YP_364501.1 lcl|fabH-XCV2770

8

325

S=304 I=31 E=8.6257e-30

3-oxoacyl-[acyl-carrier protein] synthase III

XFF4834R

lcl|fabH-XALc_1406

8

323

S=304 I=29 E=9.01004e-30

probable 3-oxoacyl-(acyl-carrier protein) synthase III

XFF4834R

NP_642885.1 lcl|fabH-XAC2571

8

325

S=303 I=30 E=1.2659e-29

3-oxoacyl-[ACP] synthase III

XFF4834R

lcl|fabH-XALc_3073

42

321

S=184 I=26 E=2.94036e-15

probable 3-oxoacyl-[acyl-carrier-protein] synthase III

XFF4834R

YP_361970.1 lcl|fabH-XCV0239

42

321

S=163 I=26 E=9.77716e-13

3-oxoacyl-(acyl carrier protein) synthase III

XFF4834R

NP_640589.1 lcl|fabH-XAC0233

42

321

S=162 I=26 E=1.69341e-12

3-oxoacyl-(acyl carrier protein) synthase III

XFF4834R

NP_635607.1 lcl|fabH-XCC0212

42

157

S=124 I=31 E=6.24148e-08

3-oxoacyl-(acyl carrier protein) synthase III

Iprscan IPR016038 [G3DSA:3.40.47.10]

8

181

Thiolase-like, subgroup

Iprscan IPR016038 [G3DSA:3.40.47.10]

211

325

Thiolase-like, subgroup

Iprscan IPR004655 [MF_01815]

5

325

Beta-ketoacyl-acyl carrier protein synthase III (FabH)

Iprscan IPR013747 [PF08541]

236

325

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal

Iprscan IPR013751 [PF08545]

110

187

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

Iprscan IPR004655 [TIGR00747]

5

325

Beta-ketoacyl-acyl carrier protein synthase III (FabH)

Iprscan IPR016039 [SSF53901]

6

324

Thiolase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Tyo2ajOJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

60 hits
swiss-prot

Swiss-Prot ncbi-blastp

344 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr11170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr11170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr11170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr11170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
fabD XFF4834R_chr11190
XFF4834R_chr_1200
XFF4834R_chr_1200
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11200
XFF4834R_chr11200
ID fabD
AC XFF4834R_chr11190
LT XFF4834R_chr11190
OR XFF4834R_chr from 1249910 to 1250854 on strand +
DE probable malonyl-CoA-[acyl-carrier-protein] transacylase
IP Malonyl CoA-acyl carrier protein transacylase; Polyketide-type polyunsaturated fatty acid synthase, PfaA; Polyketide synthase, acyl transferase domain
CL 1.5.4.3 Fatty acid biosynthesis -- initial steps
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: fatty acid biosynthetic process (GO:0006633)
Molecular Function: transferase activity (GO:0016740)
Molecular Function: binding (GO:0005488)
Molecular Function: [acyl-carrier-protein] S-malonyltransferase activity (GO:0004314)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN DNA sequence analysis and expression studies revealed that the fabD gene is part of an operon consisting of at least three genes involved in fatty acid biosynthesis.
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100723)
MW 32843.3 Da
SQ 314 aa
 
........10........20........30........40........50
| | | | |
MTESTLAFVFPGQGSQSLGMLAELSELHPQIRETFAEASEGAGVDLWALS
QGGPEEMLNRTEYTQPALLAAGVAVWRLWTAQRGQRPALLAGHSLGEYTA
LVAAGALSLHDGAHLVRLRGQFMQAAAPAGVGAMAAVLGAEDAVVQEVCA
QASGSEVVVPANFNSPGQIVIGGHAAAVDRALGLLAERGVRKAVKLAVSV
PSHTPLMREAANQLGEAMAGLTWHAPQIPVVQNVDARVHEGNTAIRQALV
EQLYLPVQWTGCVQAFASQGITRIAECGPGKVLSGLIKRIDKRLDARPLA
TPADYAGALEAWAH
XFF4834R

XFF4834R_chr05620 lcl|XFF4834R_chr05840586_0639506_f3_XFF4834R-XFF4834R_chr05620

65

310

S=162 I=27 E=3.58744e-13

XFF4834R

NP_641463.1 lcl|fabD-XAC1126

1

314

S=1496 I=93 E=3.09896e-174

acyl-carrier-protein S-malonyltransferase

XFF4834R

YP_362876.1 lcl|fabD-XCV1145

1

314

S=1489 I=92 E=2.22314e-173

acyl-carrier-protein S-malonyltransferase

XFF4834R

NP_636393.1 lcl|fabD-XCC1017

1

314

S=1419 I=87 E=7.8867e-165

acyl-carrier-protein S-malonyltransferase

XFF4834R

lcl|fabD-XALc_0625

1

313

S=1233 I=74 E=2.12888e-142

probable (acyl-carrier protein) s-malonyltransferase

XFF4834R

NP_638961.1 lcl|mdcH-XCC3615

5

297

S=210 I=30 E=1.9028e-18

acyl-carrier-protein S-malonyltransferase

XFF4834R

NP_640919.1 lcl|mdcH-XAC0566

5

310

S=157 I=27 E=6.306e-12

acyl-carrier-protein S-malonyltransferase

XFF4834R

YP_362331.1 lcl|mdcH-XCV0600

5

310

S=155 I=25 E=9.41745e-12

acyl-carrier-protein S-malonyltransferase

pubmed

4

302

S=799 I=54 E=3.38196e-88

Malonyl CoA-acyl carrier protein transacylase

Pubmed 18691538

 

prodomImg

pubmed

4

309

S=766 I=51 E=3.74244e-84

Malonyl CoA-acyl carrier protein transacylase EC=2.3.1.39 ; Acyltransferase Fatty acid biosynthesis Lipid

Pubmed 9642179

 

prodomImg

pubmed

4

310

S=764 I=50 E=7.64978e-84

Malonyl CoA-acyl carrier protein transacylase EC=2.3.1.39 ; Acyltransferase Fatty acid biosynthesis Lipid

Pubmed 1339356,1314802

 

prodomImg

pubmed

4

302

S=758 I=52 E=3.51793e-83

Malonyl-CoA:ACP transacylase EC=2.3.1.39 ; Acyltransferase

Pubmed 15060056

 

prodomImg

pubmed

4

310

S=757 I=50 E=4.1157e-83

Malonyl-CoA-[acyl-carrier-protein] transacylase

Pubmed 20088879

 

prodomImg

sp_Pdown

sp|O85140|FABD_SALTY

4

309

S=766 I=51 E=2.54872e-84

Malonyl CoA-acyl carrier protein transacylase EC=2.3.1.39 ; Acyltransferase Fatty acid biosynthesis Lipid

sp_Pdown

sp|P0AAI9|FABD_ECOLI

4

310

S=764 I=50 E=5.20973e-84

Malonyl CoA-acyl carrier protein transacylase EC=2.3.1.39 ; Acyltransferase Fatty acid biosynthesis Lipid

sp_Pdown

sp|P0AAJ0|FABD_ECOL6

4

310

S=764 I=50 E=5.20973e-84

Malonyl CoA-acyl carrier protein transacylase EC=2.3.1.39 ; Acyltransferase Fatty acid biosynthesis Lipid

sp_Pdown

sp|Q8X8I7|FABD_ECO57

4

310

S=757 I=50 E=3.45531e-83

Malonyl CoA-acyl carrier protein transacylase EC=2.3.1.39 ; Acyltransferase Fatty acid biosynthesis Lipid

sp_Pdown

sp|P43712|FABD_HAEIN

6

305

S=673 I=48 E=5.48696e-73

Malonyl CoA-acyl carrier protein transacylase EC=2.3.1.39 ; Acyltransferase Fatty acid biosynthesis Lipid

Iprscan IPR001227 [G3DSA:3.40.366.10]

4

311

Acyl transferase domain

Iprscan [PTHR10982:SF4]

6

305

-

Iprscan [PTHR10982]

6

305

-

Iprscan IPR014043 [PF00698]

8

279

Acyl transferase

Iprscan IPR020801 [SM00827]

9

312

Polyketide synthase, acyl transferase domain

Iprscan IPR004410 [TIGR00128]

4

294

Malonyl CoA-acyl carrier protein transacylase

Iprscan [seg]

125

140

-

PD000287

11

301

S=392 I=39 E=4.83282e-40

PD445507

192

304

S=249 I=44 E=1.20062e-22

PD891578

161

259

S=166 I=39 E=1.32195e-12

PD858670

141

199

S=165 I=56 E=1.58757e-12

PDA3G9P2

6

305

S=147 I=20 E=2.18831e-10

PD780088

202

310

S=134 I=27 E=1.02319e-08

PD822231

7

264

S=122 I=18 E=2.8354e-07

PD857549

63

124

S=118 I=47 E=7.72793e-07

PD543236

6

97

S=117 I=39 E=1.19506e-06

PDA1N9D0

59

311

S=109 I=25 E=8.72392e-06

Iprscan IPR016035 [SSF52151]

4

313

Acyl transferase/acyl hydrolase/lysophospholipase

Iprscan IPR016036 [SSF55048]

130

199

Malonyl-CoA ACP transacylase, ACP-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one DBpkmTd7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

48 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr11190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr11190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr11190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3k4bEV/XFF4834R_chr11190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
accD XFF4834R_chr27110
XFF4834R_chr27100
XFF4834R_chr27100
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27120
XFF4834R_chr27120
ID accD
AC XFF4834R_chr27110
LT XFF4834R_chr27110
OR XFF4834R_chr from 3125285 to 3126172 on strand -
DE probable acetyl-CoA carboxylase, beta (carboxyltranferase) subunit
IP Acetyl-CoA carboxylase carboxyl transferase, beta subunit
CL 1.5.4.3 Fatty acid biosynthesis -- initial steps
EC
GO InterPro
Biological Process: fatty acid biosynthetic process (GO:0006633)
Cellular Component: acetyl-CoA carboxylase complex (GO:0009317)
Molecular Function: ligase activity (GO:0016874)
Molecular Function: acetyl-CoA carboxylase activity (GO:0003989)

Curated
PM
AN changement de start moins 6 aa direct correlation between the levels of transcription of the acc genes and the rate of cellular growth.accA and accD are located in complex gene clusters
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110302)
MW 31981.4 Da
SQ 295 aa
 
........10........20........30........40........50
| | | | |
MSWLSKLMPSGIRTENTPAKKRSVPEGLWEKCSNCGSALYGPELEENLEV
CPKCDHHMAIRARARLNSLFDPETASTEIAAQLGPVDALKFKDQKRYGER
IKASQKASGEYDALIAMRGTLKGNPLVAAAFDFAFMGGSMGSVVGERFAR
AAEVALEVGCPFVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPY
ISVLTHPTTGGVSASFAMLGDINIAEPHALIGFAGPRVIEQTVRETLPEG
FQRSEFLLDHGAIDQICDRRQMRDRIAELTAMMMRQPHPQDADAA
XFF4834R

XFF4834R_chr05580 lcl|XFF4834R_chr05800234_0636154_f2_XFF4834R-XFF4834R_chr05580

112

244

S=94 I=28 E=5.30739e-05

XFF4834R

NP_643024.1 lcl|accD-XAC2715

1

295

S=1561 I=99 E=0

acetyl-CoA carboxylase subunit beta

XFF4834R

YP_364595.2 lcl|XCV2864

1

295

S=1555 I=99 E=0

acetyl-CoA carboxylase subunit beta

XFF4834R

NP_637888.1 lcl|accD-XCC2540

1

295

S=1457 I=96 E=1.75669e-169

acetyl-CoA carboxylase subunit beta

XFF4834R

lcl|accD-XALc_0988

1

295

S=1377 I=86 E=6.97407e-160

probable acetyl-coenzyme a carboxylase carboxyl transferase subunit beta (accase beta chain) protein

XFF4834R

NP_640915.1 lcl|mdcB-XAC0562

112

244

S=98 I=29 E=8.02885e-05

malonate decarboxylase subunit beta

pubmed

1

290

S=991 I=64 E=1.7561e-111

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta EC=6.4.1.2 ; ATP-binding Cytoplasm Fatty acid biosynthesis Ligase Lipid Metal-

Pubmed 3040739,3040734

 

prodomImg

pubmed

1

290

S=979 I=64 E=5.94699e-110

Acetyl-CoA carboxylase ; Cytoplasm

Pubmed 20088879

 

prodomImg

pubmed

2

292

S=978 I=64 E=7.79253e-110

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta EC=6.4.1.2 ; ATP-binding Cytoplasm Fatty acid biosynthesis Ligase Lipid Meta

Pubmed 11145267

 

prodomImg

pubmed

12

261

S=826 I=62 E=2.02047e-91

Carboxyl transferase subunit beta ; Cytoplasm

Pubmed 18179430

 

prodomImg

pubmed

12

259

S=818 I=62 E=1.65196e-90

Carboxyl transferase subunit beta ; Cytoplasm

Pubmed 18179430

 

prodomImg

sp_Pdown

sp|Q8PJ30|ACCD_XANAC

1

295

S=1561 I=99 E=1.1211e-180

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta EC=6.4.1.2 ; ATP-binding Cytoplasm Fatty acid biosynthesis Ligase Lipid Metal-binding

sp_Pdown

sp|Q3BRL8|ACCD_XANC5

1

295

S=1555 I=99 E=5.72426e-180

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta EC=6.4.1.2 ; ATP-binding Cytoplasm Fatty acid biosynthesis Ligase Lipid Metal-binding

sp_Pdown

sp|Q5GXR7|ACCD_XANOR

1

295

S=1552 I=98 E=1.23291e-179

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta EC=6.4.1.2 ; ATP-binding Cytoplasm Fatty acid biosynthesis Ligase Lipid Metal-binding

sp_Pdown

sp|B2SVN4|ACCD_XANOP

1

295

S=1552 I=98 E=1.23291e-179

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta EC=6.4.1.2 ; ATP-binding Cytoplasm Fatty acid biosynthesis Ligase Lipid Metal-binding

sp_Pdown

sp|Q2P0U4|ACCD_XANOM

1

295

S=1552 I=98 E=1.23291e-179

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta EC=6.4.1.2 ; ATP-binding Cytoplasm Fatty acid biosynthesis Ligase Lipid Metal-binding Nucleotide

Iprscan IPR000438 [PR01070]

133

147

Acetyl-CoA carboxylase carboxyl transferase, beta subunit

Iprscan IPR000438 [PR01070]

167

185

Acetyl-CoA carboxylase carboxyl transferase, beta subunit

Iprscan IPR000438 [PR01070]

204

221

Acetyl-CoA carboxylase carboxyl transferase, beta subunit

Iprscan IPR000438 [PR01070]

233

244

Acetyl-CoA carboxylase carboxyl transferase, beta subunit

Iprscan IPR000438 [PR01070]

255

264

Acetyl-CoA carboxylase carboxyl transferase, beta subunit

Iprscan [G3DSA:3.90.226.10]

17

290

-

Iprscan [MF_01395]

1

288

-

Iprscan [PTHR22855:SF4]

58

287

-

Iprscan [PTHR22855]

58

287

-

Iprscan IPR000022 [PF01039]

110

245

Carboxyl transferase

Iprscan IPR000438 [TIGR00515]

1

289

Acetyl-CoA carboxylase carboxyl transferase, beta subunit

Iprscan IPR011762 [PS50980]

69

262

Acetyl-coenzyme A carboxyltransferase, N-terminal

PD003130

218

293

S=267 I=66 E=7.34088e-25

PDA1F0N7

1

48

S=172 I=58 E=2.66654e-13

PDA6S5H1

47

104

S=163 I=57 E=3.01021e-12

PD003279

50

109

S=156 I=50 E=1.96198e-11

PD312146

183

268

S=153 I=37 E=4.85838e-11

PD785633

183

217

S=149 I=89 E=1.61819e-10

PD001571

105

154

S=140 I=52 E=1.79517e-09

PDA1P2A2

155

220

S=135 I=41 E=6.63866e-09

PDA7D388

126

182

S=128 I=47 E=5.92234e-08

PD301364

161

222

S=127 I=47 E=7.96589e-08

Iprscan [SSF52096]

52

287

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL