Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr11200fabGXFF4834R_chr112003-oxoacyl-[acyl-carrier-protein] reductase

fabG XFF4834R_chr11200
XFF4834R_chr11190
XFF4834R_chr11190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11210
XFF4834R_chr11210
ID fabG
AC XFF4834R_chr11200
LT XFF4834R_chr11200
OR XFF4834R_chr from 1250937 to 1251680 on strand +
DE 3-oxoacyl-[acyl-carrier-protein] reductase
IP Short-chain dehydrogenase/reductase SDR; Polyketide synthase/Fatty acid synthase, KR
CL 1.5.4.1 Fatty acid elongation - unsaturated
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Biological Process: fatty acid biosynthetic process (GO:0006633)
Molecular Function: NAD or NADH binding (GO:0051287)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: 3-oxoacyl-[acyl-carrier-protein] reductase activity (GO:0004316)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN paralogue de kduD, ucpA,3835, 3569, 0467, 1245, 3942, 3798, 2286, 2641, 3567, 4048???j espere ne pas etre passer a cote d' autres orf FEMS Microbiol Lett. 2000 Dec 1;193(1):129-36. Characterization of the acyl carrier protein gene and the fab gene locus in Xanthomonas albilineans.
CC COG: [IQR] Lipid transport and metabolism;Secondary metabolites biosynthesis, transport and catabolism;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100830)
MW 25348.9 Da
SQ 247 aa
 
........10........20........30........40........50
| | | | |
MSKLLQGEIALVTGASRGIGAAIADTLAAHGAMVIGTATSASGAAAIGER
LAAHGGHGRELNVTDAAAVDGLIDAIGKEFGAISILVNNAGITRDNLLMR
MKDDDWQAIIDTNLTSVFRTSKAVMRGMMKARKGRIINIASVVGVTGNPG
QTNYAAAKAGIIAFSKSLAKEIGSRGVTVNVVAPGFIDTDMTKALPDEAR
TALLQQIALGHLGEPEDIANAVAFLAGPTARYITGETLHVNGGMYMP
XFF4834R

XFF4834R_chr24120 lcl|XFF4834R_chr26320683_2781423_f1_XFF4834R-XFF4834R_chr24120

5

246

S=460 I=43 E=2.35799e-49

XFF4834R

XFF4834R_chr11610 lcl|XFF4834R_chr12100415_1297155_r1_XFF4834R-XFF4834R_chr11610

8

246

S=385 I=38 E=2.91032e-40

XFF4834R

XFF4834R_chr39580 lcl|XFF4834R_chr_4561110_4561841_r2_XFF4834R-XFF4834R_chr39580

10

244

S=351 I=39 E=3.16486e-36

XFF4834R

XFF4834R_chr00840 lcl|kduD-XFF4834R_chr00840

5

244

S=304 I=34 E=1.72548e-30

2-deoxy-D-gluconate 3-dehydrogenase

XFF4834R

XFF4834R_chr00540 lcl|XFF4834R_chr00550357_0067094_r2_XFF4834R-XFF4834R_chr00540

6

244

S=297 I=38 E=1.22708e-29

XFF4834R

XFF4834R_chr37030 lcl|hdhA-XFF4834R_chr37030

5

244

S=292 I=32 E=5.03834e-29

7-alpha-hydroxysteroid dehydrogenase, NAD-dependent

XFF4834R

XFF4834R_chr21510 lcl|XFF4834R_chr23410899_2494657_r3_XFF4834R-XFF4834R_chr21510

61

243

S=242 I=32 E=6.45535e-23

XFF4834R

XFF4834R_chr33850 lcl|XFF4834R_chr_3903838_3904551_f1_XFF4834R-XFF4834R_chr33850

5

242

S=234 I=33 E=5.09708e-22

predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain

XFF4834R

XFF4834R_chr04250 lcl|XFF4834R_chr_0485904_0486662_r2_XFF4834R-XFF4834R_chr04250

5

246

S=232 I=28 E=9.46593e-22

XFF4834R

XFF4834R_chr35720 lcl|XFF4834R_chr38950017_4144763_f3_XFF4834R-XFF4834R_chr35720

11

244

S=231 I=32 E=1.3652e-21

XFF4834R

NP_641464.1 lcl|fabG-XAC1127

1

247

S=1158 I=93 E=1.98954e-133

3-ketoacyl-(acyl-carrier-protein) reductase

XFF4834R

YP_362877.1 lcl|fabG-XCV1146

1

247

S=1156 I=93 E=3.47607e-133

3-ketoacyl-(acyl-carrier-protein) reductase

XFF4834R

NP_636394.1 lcl|fabG-XCC1018

1

247

S=1121 I=89 E=6.10605e-129

3-ketoacyl-(acyl-carrier-protein) reductase

XFF4834R

lcl|fabG-XALc_0626

1

247

S=1021 I=81 E=7.4522e-117

probable 3-oxoacyl-(acyl-carrier protein) reductase

XFF4834R

lcl|phbB-XALc_1098

5

246

S=469 I=42 E=6.23698e-50

putative acetoacetyl-coa reductase protein

XFF4834R

NP_642717.1 lcl|phbB-XAC2401

5

246

S=460 I=43 E=8.75559e-49

acetoacetyl-CoA reductase

XFF4834R

NP_637649.1 lcl|phbB-XCC2294

1

246

S=457 I=43 E=2.00449e-48

acetoacetyl-CoA reductase

XFF4834R

YP_364329.1 lcl|phbB-XCV2598

5

246

S=451 I=42 E=8.98012e-48

acetoacetyl-CoA reductase

XFF4834R

YP_365345.1 lcl|fabG-XCV3614

8

246

S=386 I=38 E=8.17552e-40

3-ketoacyl-(acyl-carrier-protein) reductase

XFF4834R

NP_643793.1 lcl|fabG-XAC3486

8

246

S=386 I=38 E=8.53981e-40

3-ketoacyl-(acyl-carrier-protein) reductase

pubmed

79

247

S=788 I=88 E=6.68718e-87

Ketoacyl reductase ; Oxidoreductase

Pubmed 11094291

 

prodomImg

pubmed

5

246

S=776 I=64 E=1.61182e-85

3-oxoacyl-acyl-carrier-protein reductase ; Oxidoreductase

Pubmed 20088879

 

prodomImg

pubmed

5

246

S=776 I=64 E=1.61182e-85

3-oxoacyl-[acyl-carrier-protein] reductase EC=1.1.1.100 ; Fatty acid biosynthesis Lipid NADP Oxidoreductase

Pubmed 1556094

 

prodomImg

pubmed

5

246

S=773 I=64 E=4.02625e-85

3-oxoacyl-[acyl-carrier-protein] reductase EC=1.1.1.100 ; Fatty acid biosynthesis Lipid NADP Oxidoreductase

Pubmed 9642179

 

prodomImg

pubmed

5

246

S=771 I=63 E=7.67541e-85

3-oxoacyl-[acyl-carrier-protein] reductase EC=1.1.1.100 ; Fatty acid biosynthesis Lipid NADP Oxidoreductase

Pubmed 8550484

 

prodomImg

sp_Pdown

sp|Q9KQH7|FABG_VIBCH

5

246

S=787 I=63 E=4.84979e-87

3-oxoacyl-[acyl-carrier-protein] reductase EC=1.1.1.100 ; Fatty acid biosynthesis Lipid NADP Oxidoreductase

sp_Pdown

sp|P0AEK3|FABG_SHIFL

5

246

S=776 I=64 E=1.09974e-85

3-oxoacyl-[acyl-carrier-protein] reductase EC=1.1.1.100 ; Fatty acid biosynthesis Lipid NADP Oxidoreductase

sp_Pdown

sp|P0AEK2|FABG_ECOLI

5

246

S=776 I=64 E=1.09974e-85

3-oxoacyl-[acyl-carrier-protein] reductase EC=1.1.1.100 ; Fatty acid biosynthesis Lipid NADP Oxidoreductase

sp_Pdown

sp|P0A2C9|FABG_SALTY

5

246

S=773 I=64 E=2.7471e-85

3-oxoacyl-[acyl-carrier-protein] reductase EC=1.1.1.100 ; Fatty acid biosynthesis Lipid NADP Oxidoreductase

sp_Pdown

sp|P0A2D0|FABG_SALTI

5

246

S=773 I=64 E=2.7471e-85

3-oxoacyl-[acyl-carrier-protein] reductase EC=1.1.1.100 ; Fatty acid biosynthesis Lipid NADP Oxidoreductase

Iprscan IPR002347 [PR00081]

9

26

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

81

92

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

128

144

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

154

173

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

175

192

Glucose/ribitol dehydrogenase

Iprscan IPR002347 [PR00081]

208

228

Glucose/ribitol dehydrogenase

Iprscan IPR002198 [PR00080]

81

92

Short-chain dehydrogenase/reductase SDR

Iprscan IPR002198 [PR00080]

134

142

Short-chain dehydrogenase/reductase SDR

Iprscan IPR002198 [PR00080]

154

173

Short-chain dehydrogenase/reductase SDR

Iprscan IPR016040 [G3DSA:3.40.50.720]

5

246

NAD(P)-binding domain

Iprscan [PTHR19410:SF87]

3

242

-

Iprscan IPR002198 [PTHR19410]

3

242

Short-chain dehydrogenase/reductase SDR

Iprscan IPR002198 [PF00106]

9

171

Short-chain dehydrogenase/reductase SDR

Iprscan IPR020842 [SM00822]

8

190

Polyketide synthase/Fatty acid synthase, KR

Iprscan IPR011284 [TIGR01830]

10

245

3-oxoacyl-(acyl-carrier-protein) reductase

Iprscan IPR020904 [PS00061]

141

169

Short-chain dehydrogenase/reductase, conserved site

Iprscan [seg]

35

48

-

PDA0T3J1

98

244

S=133 I=23 E=1.10614e-08

PDA27714

193

218

S=133 I=100 E=1.17575e-08

PD314213

82

244

S=132 I=23 E=1.48782e-08

PD062132

74

112

S=128 I=59 E=4.38608e-08

PD945552

157

244

S=128 I=36 E=5.13138e-08

PD259417

158

243

S=117 I=35 E=9.1155e-07

PD747329

56

111

S=116 I=41 E=1.18407e-06

PDA2U2T7

193

218

S=111 I=81 E=5.30462e-06

PD072978

73

117

S=111 I=48 E=5.30462e-06

PDA824Z0

171

244

S=111 I=35 E=5.83856e-06

Iprscan IPR016040 [SSF51735]

6

244

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one DJkevJ7q)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

29 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBELD9MF/XFF4834R_chr11200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBELD9MF/XFF4834R_chr11200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBELD9MF/XFF4834R_chr11200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBELD9MF/XFF4834R_chr11200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.