Xanthomonas fuscans subsp. fuscans

7 hits

  1. XFF4834R_chr07540ribDXFF4834R_chr07540fused diaminohydroxyphosphoribosylaminopyrimidine deaminase and 5-amino-6-(5-phosphoribosylamino) uracil reductase
  2. XFF4834R_chr07560ribCXFF4834R_chr07560probable riboflavin synthase, alpha subunit
  3. XFF4834R_chr07570ribBXFF4834R_chr07570probable 3,4-dihydroxy-2-butanone-4-phosphate synthase
  4. XFF4834R_chr07580ribEXFF4834R_chr07580probable riboflavin synthase beta chain
  5. XFF4834R_chr08520XFF4834R_chr09100491_0989678_r2_XFF4834R-XFF4834R_chr08520XFF4834R_chr08520Putative FMNH2-dependent monooxygenase
  6. XFF4834R_chr32860ribFXFF4834R_chr32860probable riboflavin biosynthesis protein RibF
  7. XFF4834R_chr36840ribAXFF4834R_chr36840probable GTP cyclohydrolase-2

ribD XFF4834R_chr07540
XFF4834R_chr07530
XFF4834R_chr07530
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07550
XFF4834R_chr07550
ID ribD
AC XFF4834R_chr07540
LT XFF4834R_chr07540
OR XFF4834R_chr from 869823 to 870932 on strand +
DE fused diaminohydroxyphosphoribosylaminopyrimidine deaminase and 5-amino-6-(5-phosphoribosylamino) uracil reductase
IP CMP/dCMP deaminase, zinc-binding; Bacterial bifunctional deaminase-reductase, C-terminal; Riboflavin-specific deaminase, C-terminal
CL 1.5.3.9 Riboflavin (Vitamin B2), FAD, FMN GO:0009231 GO:0006747 GO:0009398
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: riboflavin biosynthetic process (GO:0009231)
Molecular Function: NADP or NADPH binding (GO:0050661)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: 5-amino-6-(5-phosphoribosylamino)uracil reductase activity (GO:0008703)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: diaminohydroxyphosphoribosylaminopyrimidine deaminase activity (GO:0008835)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: validated by darrasse (20120326)
MW 38821.4 Da
SQ 369 aa
 
........10........20........30........40........50
| | | | |
MSKAATIGSADDHRWMAQALRLAERGAYTTRPNPMVGCVIVRDGVCVGEG
FHQRAGGPHAEVFALRAAGELARGATAYVTLEPCAHYGRTPPCALALIEA
GVMRVVAAMADPFPQVNGGGFALLREAGIDVLSGVMQAQARTLNRGFLSR
VERGRPWLRVKLGASLDGRTALASGESKWITSADARADVQRWRARAGAIL
TGAGTVMADDPSMTVRMGEDSPVVPPLRVVLDAGLRTLACRNIRQGDAPT
LYLHGEDVSAPSLDDAQFLAMPLHAGRFDLAAVLALLAERGINEVHVEGG
ATLSGALLQAGLVDELLVYMAPVLLGDSAKPLLAGLGIETMAQRAALQLL
DVRQLGQDLCLRYAPVVAG
XFF4834R

XFF4834R_chr21440 lcl|tadA-XFF4834R_chr21440

9

156

S=126 I=35 E=9.61427e-09

tRNA-specific adenosine deaminase

X.species

NP_641099.1 lcl|ribD-XAC0746

1

369

S=1701 I=93 E=0

5-amino-6-uracil reductase

X.species

YP_362529.1 lcl|ribD-XCV0798

1

369

S=1626 I=88 E=0

riboflavin biosynthesis protein RibD (diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-[5-phosphoribosylamino]uracil reductase)

X.species

NP_636085.1 lcl|ribD-XCC0693

9

366

S=1592 I=86 E=0

riboflavin-specific deaminase/5-amino-6-uracil reductase

X.species

lcl|ribD-XALc_2840

9

368

S=1357 I=77 E=2.65996e-157

probable riboflavin biosynthesis ribd oxidoreductase protein

X.species

NP_637525.1 lcl|XCC2169

12

158

S=133 I=35 E=5.19721e-09

hypothetical protein

X.species

NP_642364.1 lcl|XAC2038-XAC2038

6

158

S=132 I=36 E=7.17581e-09

hypothetical protein

X.species

YP_363930.1 lcl|XCV2199

6

158

S=130 I=33 E=1.35608e-08

putative cytidine / deoxycytidylate deaminase family protein

X.species

lcl|XALc_1648

9

156

S=121 I=31 E=1.77544e-07

putative cytidine / deoxycytidylate deaminase protein

pubmed

11

362

S=867 I=49 E=2.77115e-96

Diaminohydroxyphosphoribosylaminopyrimidine deaminase and 5-amino-6-(5-phosphoribosylamino)uracil reductase EC=1.1.1.193 EC=3.5.4.26 ; Hydrolase O

Pubmed 15522084,16950922

 

prodomImg

pubmed

11

362

S=867 I=49 E=2.77115e-96

Riboflavin biosynthesis protein ribD EC=3.5.4.26 EC=1.1.1.193 ; Hydrolase Metal-binding Multifunctional enzyme NADP Oxidoreductase Zinc

Pubmed 1406588

 

prodomImg

pubmed

12

359

S=768 I=47 E=2.60369e-84

Pyrimidine deaminase/pyrimidine reductase

Pubmed 12444973

 

prodomImg

pubmed

9

359

S=764 I=41 E=7.94806e-84

Pyrimidine deaminase/ pyrimidine reductase

Pubmed 12444973

 

prodomImg

pubmed

12

365

S=688 I=42 E=1.11804e-74

Riboflavin biosynthesis protein ribD EC=3.5.4.26 EC=1.1.1.193 ; Hydrolase Metal-binding Multifunctional enzyme NADP Oxidoreductase Zinc

Pubmed 9297088

 

prodomImg

pubmed

12

366

S=654 I=39 E=1.64968e-70

Riboflavin biosynthesis protein ribD EC=3.5.4.26 EC=1.1.1.193 ; Hydrolase Metal-binding Multifunctional enzyme NADP Oxidoreductase Zinc

Pubmed 7934829

 

prodomImg

pubmed

4

366

S=586 I=35 E=2.60125e-62

Riboflavin biosynthesis protein ribD EC=3.5.4.26 EC=1.1.1.193 ; Hydrolase Metal-binding Multifunctional enzyme NADP Oxidoreductase Zinc

Pubmed 8522537

 

prodomImg

pubmed

11

362

S=561 I=35 E=3.1161e-59

Riboflavin-specific deaminase/reductase

Pubmed 15466513

 

prodomImg

pubmed

11

321

S=433 I=39 E=1.01607e-43

Probable riboflavin biosynthesis protein (Deaminase/reductase) Riboflavin-specific deaminase/reductase

Pubmed 12036276

 

prodomImg

pubmed

19

327

S=410 I=35 E=6.44074e-41

Riboflavin-specific deaminase / reductase

Pubmed 10488170

 

prodomImg

sp

11

362

S=867 I=49 E=1.90664e-96

Riboflavin biosynthesis protein ribD EC=3.5.4.26 EC=1.1.1.193 ; Hydrolase Metal-binding Multifunctional enzyme NADP Oxidoreductase Zinc

 

prodomImg

sp

9

365

S=783 I=45 E=2.70327e-86

Riboflavin biosynthesis protein ribD EC=3.5.4.26 EC=1.1.1.193 ; Hydrolase Metal-binding Multifunctional enzyme NADP Oxidoreductase Zinc

 

prodomImg

Iprscan [G3DSA:3.40.140.10]

12

153

-

Iprscan [G3DSA:3.40.430.10]

279

363

-

Iprscan IPR002125 [PF00383]

9

109

CMP/dCMP deaminase, zinc-binding

Iprscan IPR002734 [PF01872]

156

361

Bacterial bifunctional deaminase-reductase, C-terminal

Iprscan IPR004794 [TIGR00326]

16

362

Riboflavin biosynthesis protein RibD

Iprscan IPR011549 [TIGR00227]

154

365

Riboflavin-specific deaminase, C-terminal

Iprscan IPR016192 [PS00903]

59

97

APOBEC/CMP deaminase, zinc-binding

Iprscan [seg]

64

77

-

PD404873

12

152

S=177 I=36 E=6.51821e-14

PD707608

14

84

S=175 I=53 E=1.00798e-13

PD859291

155

208

S=171 I=63 E=3.27063e-13

PDA128E1

98

153

S=166 I=59 E=1.1886e-12

PD005260

295

363

S=157 I=49 E=1.48978e-11

PDA3X4T8

269

365

S=149 I=56 E=1.34067e-10

PDA562F0

85

217

S=149 I=22 E=1.69651e-10

PDA1E9D8

86

136

S=134 I=54 E=8.8073e-09

PD897576

276

327

S=129 I=50 E=3.94568e-08

PD974016

298

365

S=126 I=40 E=8.72356e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one C7og87aG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

21 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07540.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07540.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07540.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07540.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ribC XFF4834R_chr07560
XFF4834R_chr07550
XFF4834R_chr07550
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07570
XFF4834R_chr07570
ID ribC
AC XFF4834R_chr07560
LT XFF4834R_chr07560
OR XFF4834R_chr from 872219 to 872821 on strand +
DE probable riboflavin synthase, alpha subunit
IP Lumazine-binding protein; Riboflavin synthase-like beta-barrel
CL 1.5.3.9 Riboflavin (Vitamin B2), FAD, FMN GO:0009231 GO:0006747 GO:0009398
EC
GO InterPro


Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 20909.5 Da
SQ 200 aa
 
........10........20........30........40........50
| | | | |
MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFDSVQLGESIAVNGVCLT
VIAFDAASFQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVS
GHVDGLGQVQSIHDDARAQRWRFAAPASVLRYVAKKGSICVDGVSLTVND
VDQDGFEVALIPHTVAHTAFAQTAVGAAVNLEIDLVARYVEHLLGTRGAA
Show or not Domain decomposition
 
X.species

YP_362531.1 lcl|ribE-XCV0800

1

200

S=940 I=92 E=4.3446e-107

riboflavin synthase subunit alpha

X.species

NP_641101.1 lcl|ribE-XAC0748

1

200

S=940 I=92 E=4.3446e-107

riboflavin synthase subunit alpha

X.species

NP_636087.1 lcl|ribE-XCC0695

1

200

S=874 I=85 E=3.88696e-99

riboflavin synthase subunit alpha

X.species

lcl|RibC-XALc_2839

1

194

S=775 I=83 E=3.71631e-87

putative riboflavin synthase, alpha subunit protein

pubmed

1

194

S=465 I=46 E=5.21912e-48

Riboflavin synthase

Pubmed 12444973

 

prodomImg

pubmed

1

199

S=441 I=44 E=3.87051e-45

Riboflavin synthase

Pubmed 12444973

 

prodomImg

pubmed

1

194

S=432 I=44 E=4.56404e-44

Riboflavin synthase alpha chain EC=2.5.1.9 ; Repeat biosynthesis Transferase

Pubmed 8144477

 

prodomImg

pubmed

1

194

S=432 I=44 E=5.6756e-44

RibE

Pubmed 15034641

 

prodomImg

pubmed

1

194

S=430 I=43 E=8.32949e-44

RibE

Pubmed 15034641,17369329

 

prodomImg

pubmed

1

194

S=430 I=43 E=8.85368e-44

RibE

Pubmed 16156737

 

prodomImg

pubmed

1

194

S=430 I=44 E=9.1679e-44

RibE

Pubmed 16156737

 

prodomImg

pubmed

1

195

S=427 I=43 E=2.31015e-43

RibE

Pubmed 18359809

 

prodomImg

pubmed

1

195

S=422 I=43 E=8.39541e-43

RibE

Pubmed 15034641,17369329

 

prodomImg

pubmed

1

195

S=421 I=42 E=1.26476e-42

RibE Riboflavin synthetase

Pubmed 11396941,15034641

 

prodomImg

sp

1

194

S=432 I=44 E=3.16285e-44

Riboflavin synthase alpha chain EC=2.5.1.9 ; Repeat biosynthesis Transferase

 

prodomImg

sp

1

199

S=420 I=43 E=8.99696e-43

Riboflavin synthase alpha chain EC=2.5.1.9 ; Repeat biosynthesis Transferase

 

prodomImg

sp

1

194

S=409 I=42 E=2.45009e-41

Riboflavin synthase alpha chain EC=2.5.1.9 ; Repeat biosynthesis Transferase

 

prodomImg

sp

1

194

S=380 I=39 E=7.72524e-38

Riboflavin synthase alpha chain EC=2.5.1.9 ; Repeat biosynthesis Transferase

 

prodomImg

sp

1

194

S=364 I=39 E=6.31098e-36

Riboflavin synthase alpha chain EC=2.5.1.9 ; Repeat biosynthesis Transferase

 

prodomImg

Iprscan [G3DSA:2.40.30.20]

1

97

-

Iprscan [G3DSA:2.40.30.20]

102

195

-

Iprscan IPR001783 [PIRSF000498]

1

197

Lumazine-binding protein

Iprscan IPR001783 [PTHR21098]

1

194

Lumazine-binding protein

Iprscan IPR001783 [PF00677]

3

87

Lumazine-binding protein

Iprscan IPR001783 [PF00677]

100

184

Lumazine-binding protein

Iprscan IPR001783 [TIGR00187]

1

200

Lumazine-binding protein

Iprscan [seg]

53

64

-

PD004110

96

194

S=260 I=47 E=5.77256e-24

Iprscan IPR017938 [SSF63380]

94

195

Riboflavin synthase-like beta-barrel

Iprscan IPR017938 [SSF63380]

1

93

Riboflavin synthase-like beta-barrel

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 7Fg4ywRl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

50 hits
swiss-prot

Swiss-Prot ncbi-blastp

23 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07560.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07560.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ribB XFF4834R_chr07570
XFF4834R_chr07560
XFF4834R_chr07560
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07580
XFF4834R_chr07580
ID ribB
AC XFF4834R_chr07570
LT XFF4834R_chr07570
OR XFF4834R_chr from 872818 to 873957 on strand +
DE probable 3,4-dihydroxy-2-butanone-4-phosphate synthase
IP DHBP synthase RibB
CL 1.5.3.9 Riboflavin (Vitamin B2), FAD, FMN GO:0009231 GO:0006747 GO:0009398
EC
GO InterPro
4-dihydroxy-2-butanone-4-phosphate synthase activity (GO:0008686)
Biological Process: riboflavin biosynthetic process (GO:0009231)
Molecular Function: GTP cyclohydrolase II activity (GO:0003935)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 41131.5 Da
SQ 379 aa
 
........10........20........30........40........50
| | | | |
MNFAPVPELIEELRAGRMVVIVDDEDRENEGDLIMAAELVKPSDINFMVT
HARGLVCLSLTRERCAQLGLAPMVRNNTAQFQTNFTVSIEAAEGVTTGIS
AYDRAHTVRTAVRPDARPQDLSQPGHIFPLISQPGGVLTRAGHTEAASDL
PMLAGLEPAGVLVEVLNPDGSMARRPQLEVFAREHGLKMGSIADLIAYRL
ANEHTVERVDEREITTEFGPFKLVTYRDRIAHDLHFALLRGRADPQTPTL
VRVQVENPLADLLHWQRDDFGVAATDALRAIAAEGQGVMVVLSAPRDSES
LLARLRQQPEAAANAKDVSQWRRNGAGAQILADLGLGKLRVLGTPRRQVG
LAGFGLEVVEYLECHAGEGARAVPPSAVP
Show or not Domain decomposition
 
X.species

NP_641102.1 lcl|ribA-XAC0749

1

379

S=1965 I=99 E=0

3,4-dihydroxy-2-butanone 4-phosphate synthase

X.species

YP_362532.1 lcl|ribB-XCV0801

1

379

S=1954 I=99 E=0

riboflavin biosynthesis protein RibB (GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase)

X.species

NP_636088.1 lcl|ribA-XCC0696

1

371

S=1849 I=95 E=0

GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4- phosphate synthase

X.species

lcl|RibB-XALc_2838

1

356

S=1634 I=88 E=0

putative gtp cyclohydrolase II /3,4-dihydroxy-2-butanone 4-phosphate synthase, riboflavin biosynthesis protein

pubmed

1

365

S=986 I=52 E=1.09509e-110

RibB ; Metal-binding Riboflavin biosynthesis

Pubmed 18359809

 

prodomImg

pubmed

1

362

S=985 I=55 E=1.33826e-110

GTP cyclohydrolase II/ 3,4-dihydroxy-2-butanone 4-phosphate synthase ; Metal-binding Riboflavin biosynthesis

Pubmed 12444973

 

prodomImg

pubmed

1

362

S=974 I=50 E=2.46168e-109

RibB ; Metal-binding Riboflavin biosynthesis

Pubmed 15034641,17369329

 

prodomImg

pubmed

1

365

S=970 I=51 E=8.86847e-109

DHBP synthetase ; Metal-binding Riboflavin biosynthesis

Pubmed 11396941

 

prodomImg

pubmed

1

365

S=969 I=51 E=1.29023e-108

RibB ; Metal-binding Riboflavin biosynthesis

Pubmed 15034641,17369329

 

prodomImg

pubmed

1

365

S=967 I=51 E=2.13937e-108

RibB ; Metal-binding Riboflavin biosynthesis

Pubmed 15034641,17369329

 

prodomImg

pubmed

1

362

S=967 I=52 E=2.177e-108

RibB ; Metal-binding Riboflavin biosynthesis

Pubmed 17586644

 

prodomImg

pubmed

1

362

S=963 I=52 E=6.36208e-108

RibB ; Metal-binding Riboflavin biosynthesis

Pubmed 17586644

 

prodomImg

pubmed

1

362

S=962 I=52 E=8.40944e-108

3,4-dihydroxy-2-butanone 4-phosphate synthase EC=4.1.99.12 ; Lyase Magnesium Manganese Metal-binding Riboflavin biosynthesis

Pubmed 1339274

 

prodomImg

pubmed

1

362

S=960 I=52 E=1.53474e-107

RibB ; Metal-binding Riboflavin biosynthesis

Pubmed 17586644

 

prodomImg

sp

1

362

S=962 I=52 E=5.79056e-108

3,4-dihydroxy-2-butanone 4-phosphate synthase EC=4.1.99.12 ; Lyase Magnesium Manganese Metal-binding Riboflavin biosynthesis

 

prodomImg

sp

1

362

S=957 I=55 E=2.05005e-107

3,4-dihydroxy-2-butanone 4-phosphate synthase EC=4.1.99.12 ; Lyase Magnesium Manganese Metal-binding Riboflavin biosynthesis

 

prodomImg

sp

1

362

S=926 I=50 E=1.14922e-103

3,4-dihydroxy-2-butanone 4-phosphate synthase EC=4.1.99.12 ; Lyase Magnesium Manganese Metal-binding Riboflavin biosynthesis

 

prodomImg

sp

1

362

S=922 I=53 E=3.99829e-103

3,4-dihydroxy-2-butanone 4-phosphate synthase EC=4.1.99.12 ; Lyase Magnesium Manganese Metal-binding Riboflavin biosynthesis

 

prodomImg

sp

2

364

S=850 I=49 E=2.29118e-94

3,4-dihydroxy-2-butanone 4-phosphate synthase EC=4.1.99.12 ; Lyase Magnesium Manganese Metal-binding Riboflavin biosynthesis

 

prodomImg

Iprscan IPR017945 [G3DSA:3.90.870.10]

3

212

DHBP synthase RibB-like alpha/beta domain

Iprscan IPR016299 [PIRSF001259]

1

378

Riboflavin biosynthesis protein RibA

Iprscan [PTHR21327:SF1]

33

354

-

Iprscan [PTHR21327]

33

354

-

Iprscan IPR000422 [PF00926]

7

199

DHBP synthase RibB

Iprscan IPR000926 [PF00925]

206

362

GTP cyclohydrolase II

Iprscan IPR000422 [TIGR00506]

2

199

DHBP synthase RibB

PD003034

6

199

S=646 I=65 E=9.51406e-71

PD003336

219

292

S=124 I=41 E=1.61887e-07

Iprscan IPR017945 [SSF55821]

1

203

DHBP synthase RibB-like alpha/beta domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 2Yd105SX)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

55 hits
swiss-prot

Swiss-Prot ncbi-blastp

264 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07570.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07570.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ribE XFF4834R_chr07580
XFF4834R_chr07570
XFF4834R_chr07570
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07590
XFF4834R_chr07590
ID ribE
AC XFF4834R_chr07580
LT XFF4834R_chr07580
OR XFF4834R_chr from 874290 to 874754 on strand +
DE probable riboflavin synthase beta chain
IP 6,7-dimethyl-8-ribityllumazine synthase
CL 1.5.3.9 Riboflavin (Vitamin B2), FAD, FMN GO:0009231 GO:0006747 GO:0009398
EC
GO InterPro
Biological Process: riboflavin biosynthetic process (GO:0009231)
Cellular Component: riboflavin synthase complex (GO:0009349)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 16241.3 Da
SQ 154 aa
 
........10........20........30........40........50
| | | | |
MTHYEGDLRPTTARFAIIASRWNARITDVLVAGARQSLAGNGIGEDAIDV
IRVPGAWEIPIAANRVAQSGQHGAIIALGCVIRGDTRHYEHVADLCAEGL
MSVQLQTGVPVLNGVLAVERVEDAEARAGGSHGNKGEECALAALELVNLM
ELLP
Show or not Domain decomposition
 
X.species

YP_362533.1 lcl|ribH-XCV0802

1

154

S=724 I=92 E=3.57309e-81

riboflavin synthase subunit beta

X.species

NP_641103.1 lcl|ribH-XAC0750

1

154

S=724 I=92 E=3.57309e-81

riboflavin synthase subunit beta

X.species

NP_636089.1 lcl|ribH-XCC0697

1

154

S=698 I=88 E=6.39223e-78

riboflavin synthase subunit beta

X.species

lcl|RibH-XALc_2837

1

154

S=550 I=73 E=4.60055e-60

putative 6,7-dimethyl-8-ribityllumazine synthase, riboflavin synthase beta subunit protein

pubmed

1

151

S=325 I=44 E=2.62231e-31

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 8522537

 

prodomImg

pubmed

3

151

S=323 I=44 E=4.74424e-31

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 14729744

 

prodomImg

pubmed

3

151

S=323 I=44 E=4.74424e-31

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 15590099

 

prodomImg

pubmed

3

151

S=323 I=44 E=4.74424e-31

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 14729744

 

prodomImg

pubmed

3

151

S=323 I=44 E=4.74424e-31

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 14729744

 

prodomImg

pubmed

1

150

S=305 I=41 E=7.85342e-29

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 15466513

 

prodomImg

pubmed

1

153

S=301 I=42 E=2.48243e-28

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 19014707

 

prodomImg

pubmed

1

150

S=300 I=42 E=2.95534e-28

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 12444973

 

prodomImg

pubmed

1

154

S=300 I=44 E=3.4275e-28

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 17586644

 

prodomImg

pubmed

1

154

S=300 I=44 E=3.4275e-28

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

Pubmed 17586644

 

prodomImg

sp

1

154

S=724 I=92 E=7.98407e-80

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

 

prodomImg

sp

1

154

S=724 I=92 E=7.98407e-80

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

 

prodomImg

sp

1

154

S=716 I=91 E=9.09199e-79

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

 

prodomImg

sp

1

154

S=716 I=91 E=9.09199e-79

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

 

prodomImg

sp

1

154

S=698 I=88 E=1.42834e-76

6,7-dimethyl-8-ribityllumazine synthase EC=2.5.1.9 ; Riboflavin biosynthesis Transferase

 

prodomImg

Iprscan IPR002180 [G3DSA:3.40.50.960]

2

153

6,7-dimethyl-8-ribityllumazine synthase

Iprscan IPR002180 [PTHR21058]

2

154

6,7-dimethyl-8-ribityllumazine synthase

Iprscan IPR002180 [PF00885]

11

151

6,7-dimethyl-8-ribityllumazine synthase

Iprscan IPR002180 [TIGR00114]

13

150

6,7-dimethyl-8-ribityllumazine synthase

Iprscan [seg]

117

128

-

PD003664

14

136

S=300 I=48 E=6.86924e-29

Iprscan IPR002180 [SSF52121]

1

154

6,7-dimethyl-8-ribityllumazine synthase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one bVa0Xy4e)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

64 hits
swiss-prot

Swiss-Prot ncbi-blastp

535 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07580.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07580.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr07580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr09100491_0989678_r2_XFF4834R-XFF4834R_chr08520 XFF4834R_chr08520
XFF4834R_chr08510
XFF4834R_chr08510
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08530
XFF4834R_chr08530
ID XFF4834R_chr09100491_0989678_r2_XFF4834R-XFF4834R_chr08520
AC XFF4834R_chr08520
LT XFF4834R_chr08520
OR XFF4834R_chr from 988491 to 989678 on strand -
DE Putative FMNH2-dependent monooxygenase
IP Acyl-CoA dehydrogenase/oxidase; Acyl-CoA dehydrogenase, type 2, C-terminal; Acyl-CoA oxidase/dehydrogenase, type1/2, C-terminal
CL 1.5.3.9 Riboflavin (Vitamin B2), FAD, FMN GO:0009231 GO:0006747 GO:0009398
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995)
Molecular Function: oxidoreductase activity (GO:0016491)
acting on the CH-CH group of donors (GO:0016627)

Curated
PM
AN le gene s appelle msuC chez xac, sfnC chez P.putida, msuC chez P.aeruginosa aucun n existe chez coli...
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100723)
MW 43706.1 Da
SQ 395 aa
 
........10........20........30........40........50
| | | | |
MTSRQPQPTLLNPLQTAQRLAAGFADTAIERDARGGTPKAERDALRASGL
LALSIPVQYGGLGASWSEVLQVVRTFAKVDSSIAHVFGFHHLMLATVRLF
GQPAQWQPWLEQTARKQWFWGNALNPLDTRTVAVQCEGWREFSGRKSFCS
GAIDSQMLIASALDERSGNLLIGAIPTARSGITLGHDWDNIGQRQTDSGS
TTFERVRVEESELLLDPGPLSTPFACLRPLIAQLLFAHLFLGIAEGAFEE
ARSYTLGEARAWHRSGVEQASEDPYILAHYGEFWLGLESARLLTERAAGL
LDAAWRKEHALGRDERAQVALAVAAAKVATTRVGLEVCSKLFEVTGARAT
HAALRLDRYWRNLRTQTLHDPVDYKLRELGEWALRHQPPTPSFYS
XFF4834R

XFF4834R_chr08590 lcl|XFF4834R_chr09180369_0998661_f1_XFF4834R-XFF4834R_chr08590

45

395

S=256 I=27 E=2.18438e-24

X.species

NP_641198.1 lcl|msuC-XAC0846

1

395

S=1902 I=93 E=0

FMNH2-dependent monooxygenase

X.species

NP_641206.1 lcl|XAC0854-XAC0854

45

395

S=253 I=27 E=2.01203e-23

hypothetical protein

pubmed

14

395

S=1387 I=69 E=2.8218e-159

Putative FMNH2-dependent monooxygenase

Pubmed 12835925,12686641

 

prodomImg

pubmed

5

376

S=1342 I=69 E=8.9602e-154

Putative FMNH2-dependent monooxygenase

Pubmed 10049377

 

prodomImg

pubmed

14

395

S=733 I=42 E=4.90588e-80

Thermophilic dibenzothiophene desulfurization enzyme C

Pubmed 10733908

 

prodomImg

pubmed

12

395

S=689 I=40 E=1.06146e-74

Dibenzothiophene desulfurization enzyme C ; FAD Flavoprotein Oxidoreductase

Pubmed 15221222

 

prodomImg

pubmed

12

395

S=688 I=40 E=1.47839e-74

Dibenzothiophene desulfurization enzyme C ; FAD Flavoprotein Oxidoreductase

Pubmed 16820450

 

prodomImg

sp

12

395

S=688 I=40 E=1.00539e-74

Dibenzothiophene desulfurization enzyme C ; Oxidoreductase Plasmid

 

prodomImg

sp

14

371

S=150 I=24 E=1.60676e-09

Putative acyl-CoA dehydrogenase ydbM EC=1.3.99.- ; FAD Flavoprotein Oxidoreductase

 

prodomImg

Iprscan IPR013786 [G3DSA:1.10.540.10]

7

119

Acyl-CoA dehydrogenase/oxidase, N-terminal

Iprscan IPR006091 [G3DSA:2.40.110.10]

125

219

Acyl-CoA oxidase/dehydrogenase, central domain

Iprscan IPR013764 [G3DSA:1.20.140.10]

231

370

Acyl-CoA oxidase/dehydrogenase, type1/2, C-terminal

Iprscan [PTHR10909:SF8]

76

370

-

Iprscan [PTHR10909]

76

370

-

Iprscan IPR013107 [PF08028]

235

369

Acyl-CoA dehydrogenase, type 2, C-terminal

Iprscan IPR006092 [PF02771]

21

115

Acyl-CoA dehydrogenase, N-terminal

Iprscan [seg]

204

215

-

Iprscan [seg]

317

329

-

PD734257

90

203

S=254 I=47 E=2.84797e-23

PD394280

338

389

S=153 I=60 E=4.63461e-11

PDA1L9H3

283

316

S=128 I=76 E=4.16378e-08

PD708457

231

283

S=127 I=51 E=5.50371e-08

Iprscan IPR009100 [SSF56645]

2

217

Acyl-CoA dehydrogenase/oxidase

Iprscan IPR009075 [SSF47203]

231

388

Acyl-CoA dehydrogenase/oxidase C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0BgA2ksP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr08520.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr08520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr08520.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr08520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ribF XFF4834R_chr32860
XFF4834R_chr32850
XFF4834R_chr32850
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32870
XFF4834R_chr32870
ID ribF
AC XFF4834R_chr32860
LT XFF4834R_chr32860
OR XFF4834R_chr from 3785297 to 3786319 on strand -
DE probable riboflavin biosynthesis protein RibF
IP Riboflavin kinase/FAD synthetase; Rossmann-like alpha/beta/alpha sandwich fold; FAD synthetase; Riboflavin kinase
CL 1.5.3.9 Riboflavin (Vitamin B2), FAD, FMN GO:0009231 GO:0006747 GO:0009398
EC
GO InterPro
Biological Process: riboflavin biosynthetic process (GO:0009231)
Molecular Function: FMN adenylyltransferase activity (GO:0003919)
Molecular Function: riboflavin kinase activity (GO:0008531)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100409)
MW 37126.2 Da
SQ 340 aa
 
........10........20........30........40........50
| | | | |
MSRLFRDVEGGTLFPRGSVVCIGAFDGLHLGHRTLVQHAVARARALGVPA
VAVSFEPLPREFFAPAALPPRLTLARAKIEGLYGFGADSVGMIRFDGRLS
KMCAEDFVRLALVGRLCAREVWIGPEFRFGHRRAGDIGLLRTLGEQHGFV
AGEIAPVHLHGERISATRIRELLGAGEFAHAGDLLGRPYAIGGRVVRGKQ
LGRTLGYPTANLRFPRTPALSGIYATWVHGVAERPWPSVSSFGTRPTVAG
VEPLLEAHLFDFQCDLYGRHIAVEFVAKLRDEEKFDGLEALTVQMHRDAE
QAREVLAAHMRSEQQPSTTASPSQEPARPCADFSSNPAQR
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AabeemuV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

48 hits
swiss-prot

Swiss-Prot ncbi-blastp

18 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr32860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr32860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr32860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr32860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ribA XFF4834R_chr36840
XFF4834R_chr36830
XFF4834R_chr36830
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr36850
XFF4834R_chr36850
ID ribA
AC XFF4834R_chr36840
LT XFF4834R_chr36840
OR XFF4834R_chr from 4261076 to 4262209 on strand +
DE probable GTP cyclohydrolase-2
IP Riboflavin biosynthesis protein RibA
CL 1.5.3.9 Riboflavin (Vitamin B2), FAD, FMN GO:0009231 GO:0006747 GO:0009398
EC
GO InterPro
Biological Process: riboflavin biosynthetic process (GO:0009231)
Molecular Function: GTP cyclohydrolase II activity (GO:0003935)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100409)
MW 39467.5 Da
SQ 377 aa
 
........10........20........30........40........50
| | | | |
MSSPLPSPSTQAFGDPAAIRCERAASELRAGRPVLLTAANGQARAVLALD
SSTAQSYAAFARAARGRHYLFVTPTRAQVLGLSAPQGARVGLIDHSYDQL
AALAYLRDTPVPAQWTAGDALDAGGVEIARLGLLLPALLAVELRDVHDHA
AFAGCQSLALDDLSRGCATSAAAGYELVTRTPVPLRGLGMSEFVVFRGGV
AQRDQVAIVVGQPDLSTAVAVRVHSSCLTGDLFGSLKCDCGDQLRHGLAK
LKELGGGVLLYLDQEGRGTGIAAKMRAYGYQHAGLDTIDADAQLGFGPDE
RRYGSAVAMLRGLGIGRIRLLTNNPAKAERLRAAGIVVEDRIAITGDITA
ENEQYLRTKAARAGHALDVDALILAAQ
Hamap RIBA_MF_00179 raw_score=5109 norm_score=38.273

GTP cyclohydrolase-2 [ribA].

X.species

NP_644098.1 lcl|ribA-XAC3792

1

377

S=1689 I=89 E=0

GTP cyclohydrolase

X.species

YP_365647.1 lcl|XCV3916

1

377

S=1672 I=88 E=0

GTP cyclohydrolase

X.species

NP_639085.1 lcl|ribA-XCC3740

1

377

S=1535 I=81 E=8.64723e-179

GTP cyclohydrolase

X.species

lcl|RibA-XALc_2850

1

377

S=1248 I=68 E=4.03754e-144

putative gtp cyclohydrolase II, riboflavin biosynthesis protein

pubmed

20

369

S=388 I=28 E=2.6025e-38

GTP cyclohydrolase-2 EC=3.5.4.25 ; Riboflavin biosynthesis

Pubmed 18582562

 

prodomImg

pubmed

183

365

S=384 I=45 E=9.05444e-38

GTP cyclohydrolase-2 EC=3.5.4.25 ; GTP-binding Metal-binding Nucleotide-binding Riboflavin biosynthesis Zinc

Pubmed 7883178

 

prodomImg

pubmed

11

369

S=376 I=27 E=9.04688e-37

GTP cyclohydrolase-2 EC=3.5.4.25 ; Riboflavin biosynthesis

Pubmed 11053403

 

prodomImg

pubmed

178

367

S=375 I=40 E=9.28664e-37

Riboflavin biosynthesis protein ribBA EC=4.1.99.12 EC=3.5.4.25 ; GTP-binding Hydrolase Lyase Magnesium Manganese Metal-binding Multifunctional enzyme

Pubmed 18391199

 

prodomImg

pubmed

14

369

S=369 I=27 E=5.40421e-36

GTP cyclohydrolase-2 EC=3.5.4.25 ; Riboflavin biosynthesis

Pubmed 11053403

 

prodomImg

pubmed

176

368

S=368 I=40 E=7.52696e-36

GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase ; Metal-binding Riboflavin biosynthesis

Pubmed 15466513

 

prodomImg

pubmed

196

367

S=356 I=43 E=2.10409e-34

Riboflavin biosynthesis protein ribBA EC=4.1.99.12 EC=3.5.4.25 ; GTP-binding Hydrolase Lyase Magnesium Manganese Metal-binding Multifunctional enzyme

Pubmed 9297088

 

prodomImg

pubmed

179

372

S=355 I=43 E=2.80556e-34

GTP cyclohydrolase-2 EC=3.5.4.25 ; Riboflavin biosynthesis

Pubmed 17541777

 

prodomImg

pubmed

191

369

S=354 I=39 E=3.67621e-34

GTP cyclohydrolase-2 EC=3.5.4.25 ; Riboflavin biosynthesis

Pubmed 11396941

 

prodomImg

pubmed

180

368

S=350 I=42 E=1.16204e-33

GTP cyclohydrolase-2 EC=3.5.4.25 ; GTP-binding Metal-binding Nucleotide-binding Riboflavin biosynthesis Zinc

Pubmed 8320220

 

prodomImg

sp

1

377

S=1192 I=62 E=8.12636e-136

GTP cyclohydrolase-2 EC=3.5.4.25 ; GTP-binding Metal-binding Nucleotide-binding Riboflavin biosynthesis Zinc

 

prodomImg

sp

1

377

S=1192 I=62 E=8.26931e-136

GTP cyclohydrolase-2 EC=3.5.4.25 ; GTP-binding Metal-binding Nucleotide-binding Riboflavin biosynthesis Zinc

 

prodomImg

sp

183

365

S=384 I=45 E=6.23501e-38

GTP cyclohydrolase-2 EC=3.5.4.25 ; GTP-binding Metal-binding Nucleotide-binding Riboflavin biosynthesis Zinc

 

prodomImg

sp

178

367

S=375 I=40 E=6.3949e-37

Riboflavin biosynthesis protein ribBA EC=4.1.99.12 EC=3.5.4.25 ; GTP-binding Hydrolase Lyase Magnesium Manganese Metal-binding Multifunctional enzyme

 

prodomImg

sp

189

372

S=372 I=40 E=1.91838e-36

Riboflavin biosynthesis protein ribBA EC=4.1.99.12 EC=3.5.4.25 ; GTP-binding Hydrolase Lyase Magnesium Manganese Metal-binding Multifunctional enzyme

 

prodomImg

Iprscan [MF_00179]

173

369

-

Iprscan IPR016299 [PIRSF001259]

1

372

Riboflavin biosynthesis protein RibA

Iprscan IPR000926 [PF00925]

176

344

GTP cyclohydrolase II

Iprscan [seg]

58

67

-

Iprscan [seg]

129

143

-

Iprscan [seg]

310

321

-

PD310044

13

190

S=613 I=72 E=8.48306e-67

PD003336

180

299

S=277 I=47 E=4.2258e-26

PDA1T3Y5

344

377

S=159 I=94 E=8.53738e-12

PDA1T3Y7

344

377

S=115 I=62 E=2.01546e-06

PDA1H3V8

285

338

S=104 I=44 E=4.81574e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ubTvr23V)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

185 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr36840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr36840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr36840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8RLPET/XFF4834R_chr36840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.