Xanthomonas fuscans subsp. fuscans

10 hits

  1. XFF4834R_chr07600thiLXFF4834R_chr07600probable thiamin-monophosphate kinase
  2. XFF4834R_chr12000thiCXFF4834R_chr12000probable thiamine biosynthesis protein thiC
  3. XFF4834R_chr12290thiEXFF4834R_chr12290probable thiamine-phosphate pyrophosphorylase
  4. XFF4834R_chr13380thiGXFF4834R_chr13380probable thiazole synthase
  5. XFF4834R_chr13390thiSXFF4834R_chr13390probable sulphur carrier protein ThiS
  6. XFF4834R_chr16920apbEXFF4834R_chr16920putative thiamine biosynthesis lipoprotein ApbE
  7. XFF4834R_chr17010sufSXFF4834R_chr17010cysteine desulfurase
  8. XFF4834R_chr21010nudJXFF4834R_chr21010probable bifunctional thiamin pyrimidine pyrophosphate hydrolase/ thiamin pyrophosphate hydrolase
  9. XFF4834R_chr24190XFF4834R_chr_2788586_2790265_r3_XFF4834R-XFF4834R_chr24190XFF4834R_chr24190putative carbohydrate kinase, YjeF-like protein
  10. XFF4834R_chr27590thiDXFF4834R_chr27590probable phosphomethylpyrimidine kinase

thiL XFF4834R_chr07600
XFF4834R_chr07590
XFF4834R_chr07590
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07610
XFF4834R_chr07610
ID thiL
AC XFF4834R_chr07600
LT XFF4834R_chr07600
OR XFF4834R_chr from 875443 to 876417 on strand +
DE probable thiamin-monophosphate kinase
IP AIR synthase related protein; AIR synthase related protein, C-terminal
CL 1.5.3.8 Thiamine (Vitamin B1) GO:0009228
EC
GO InterPro
Biological Process: thiamin biosynthetic process (GO:0009228)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: thiamin phosphate kinase activity (GO:0009030)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 33978.2 Da
SQ 324 aa
 
........10........20........30........40........50
| | | | |
MPEFDLIARLRARIAARADVPLGIGDDAALLQPPAGEQLAITADTLNAGV
HFPHETRADDLGWKTLAVNLSDLAAMGAQPRWCTLSLSLPHDDAAWVDGF
ADGFFALADAHEIVLVGGDTTRGPLSCAVTAIGSLPPGAALRRDGARVGD
DVWVTGAPGEAAAALALWQAGQLDVTCPATDPLHERWRGRLLRPQPRVQA
GLRLRGLAHACVDISDGLLADLGHLCERSGVGARLVLAALPAMPRSAGID
VVQCLGWQLGGGDDYELCFTAAPQHRDAVAQAMEFATVAATRIGQIVAAP
GVVVHDAEGNPWQPPQRGYQHFVG
XFF4834R

YP_362535.1 lcl|thiL-XCV0804

1

324

S=1356 I=84 E=2.74555e-157

thiamine monophosphate kinase

XFF4834R

NP_641105.1 lcl|thiL-XAC0752

1

324

S=1309 I=84 E=1.6912e-151

thiamine monophosphate kinase

XFF4834R

NP_636091.1 lcl|thiL-XCC0699

1

324

S=1216 I=76 E=3.1668e-140

thiamine monophosphate kinase

XFF4834R

lcl|XALc_2835

1

324

S=900 I=61 E=5.08694e-102

putative thiamine monophosphate kinase protein

pubmed

20

322

S=338 I=38 E=2.72627e-32

Thiamin-monophosphate kinase-like protein

Pubmed 11844780

 

prodomImg

pubmed

1

322

S=306 I=29 E=1.85145e-28

Thiamine-monophosphate kinase EC=2.7.4.16 ; ATP-binding Nucleotide-binding biosynthesis Transferase

Pubmed 9202461

 

prodomImg

pubmed

19

83

S=153 I=51 E=6.92338e-10

Thiamin monophosphate kinase

Pubmed 12444973

 

prodomImg

sp_Pdown

sp|P0AGG0|THIL_ECOLI

19

322

S=523 I=43 E=6.05294e-55

Thiamine-monophosphate kinase EC=2.7.4.16 ; ATP-binding Nucleotide-binding biosynthesis Transferase

sp_Pdown

sp|P0AGG1|THIL_ECOL6

19

322

S=523 I=43 E=6.05294e-55

Thiamine-monophosphate kinase EC=2.7.4.16 ; ATP-binding Nucleotide-binding biosynthesis Transferase

sp_Pdown

sp|Q8XE87|THIL_ECO57

19

322

S=519 I=43 E=2.42114e-54

Thiamine-monophosphate kinase EC=2.7.4.16 ; ATP-binding Nucleotide-binding biosynthesis Transferase

sp_Pdown

sp|P55881|THIL_SALTY

19

322

S=509 I=43 E=3.28235e-53

Thiamine-monophosphate kinase EC=2.7.4.16 ; ATP-binding Nucleotide-binding biosynthesis Transferase

sp_Pdown

sp|Q8K9A5|THIL_BUCAP

23

323

S=499 I=34 E=5.11605e-52

Thiamine-monophosphate kinase EC=2.7.4.16 ; ATP-binding Nucleotide-binding biosynthesis Transferase

Iprscan [G3DSA:3.30.1330.10]

1

139

-

Iprscan [G3DSA:3.90.650.10]

142

322

-

Iprscan IPR006283 [PIRSF005303]

1

323

Thiamine-monophosphate kinase

Iprscan IPR000728 [PF00586]

25

120

AIR synthase related protein

Iprscan IPR010918 [PF02769]

147

304

AIR synthase related protein, C-terminal

Iprscan IPR006283 [TIGR01379]

2

322

Thiamine-monophosphate kinase

Iprscan [seg]

6

18

-

Iprscan [seg]

98

110

-

Iprscan [seg]

156

173

-

PDA1V976

279

324

S=227 I=96 E=4.70329e-20

PD553796

222

279

S=134 I=48 E=9.19941e-09

PDA2E1R9

1

38

S=111 I=66 E=6.8223e-06

PDA8W3D3

259

323

S=108 I=39 E=1.25599e-05

Iprscan IPR016188 [SSF55326]

3

141

PurM, N-terminal-like

Iprscan IPR010918 [SSF56042]

144

315

AIR synthase related protein, C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CqUUEK0P)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

12 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr07600.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr07600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr07600.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr07600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
thiC XFF4834R_chr12000
XFF4834R_chr12000
XFF4834R_chr12000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1286
XFF4834R_chr_1286
ID thiC
AC XFF4834R_chr12000
LT XFF4834R_chr12000
OR XFF4834R_chr from 1352600 to 1354477 on strand +
DE probable thiamine biosynthesis protein thiC
IP Thiamine biosynthesis protein ThiC
CL 1.5.3.8 Thiamine (Vitamin B1) GO:0009228
EC
GO InterPro
Biological Process: thiamin biosynthetic process (GO:0009228)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 69145 Da
SQ 625 aa
 
........10........20........30........40........50
| | | | |
MNAAPTVLQQQAQSLSEAVTQPIPGSRKIFVRGSRADLQVPMREIALTRT
PTLFGGEENPPLSVYDTSGPYTDPRVAIDLAAGLAPLRAQWIAERGDTVA
LGGLSSSFGRGREHDARLDAVRFPARRLPRVARQGANVTQMHYARRGIIT
PEMEYVAIRENQRLEAVTDASLRKQHPGQAFGASIQQRITPEFVREEIAR
GRAILPNNINHPESEPMIIGRNFLTKINANIGNSAVSSGIAEEVEKLVWS
IRWGGDTVMDLSTGKHIHETREWIIRNSPVPIGTVPIYQALEKVDGRAEE
LTWDIFRDTLIEQAEQGVDYFTIHAGVLLRYVPLTAKRVTGIVSRGGSIM
AKWCLAHHKENFLYTHFEDICQIMKAYDVAFSLGDGLRPGCIADANDAAQ
FGELETLGELTKLAWKHDVQTMIEGPGHVPMQLIKENMDKQLRECGEAPF
YTLGPLTTDIAPGYDHITSAIGAAMIGWFGTAMLCYVTPKEHLGLPNRQD
VRDGIMAYKIAAHAADLAKGHPGAQVRDNALSKARFEFRWDDQFHLGLDP
EKAKEFHDETLPKDAHKLAHFCSMCGPHFCSMKITQDVRDYAAEHGMSEA
QALSTGMQEKSAQFVAQGAQVYRAT
XFF4834R

NP_643754.1 lcl|thiC-XAC3447

1

625

S=3216 I=96 E=0

thiamine biosynthesis protein ThiC

XFF4834R

YP_365306.1 lcl|thiC-XCV3575

1

625

S=3202 I=95 E=0

thiamine biosynthesis protein ThiC

XFF4834R

NP_638665.1 lcl|thiC-XCC3319

1

625

S=3090 I=91 E=0

thiamine biosynthesis protein ThiC

XFF4834R

lcl|thiC-XALc_0761

1

624

S=2930 I=87 E=0

probable thiamine biosynthesis protein thic.

pubmed

1

622

S=2273 I=69 E=0

Thiamine biosynthesis protein thiC

Pubmed 19077236

 

prodomImg

pubmed

23

622

S=2214 I=67 E=0

Thiamine biosynthesis protein thiC

Pubmed 8432721,8265357

 

prodomImg

pubmed

18

602

S=2084 I=67 E=0

Thiamine biosynthesis protein thiC ; Plasmid

Pubmed 11481431

 

prodomImg

pubmed

13

602

S=2081 I=67 E=0

Thiamine biosynthesis protein thiC

Pubmed 12003951

 

prodomImg

pubmed

12

602

S=2077 I=67 E=0

Thiamine biosynthesis protein thiC ; Plasmid

Pubmed 9371431

 

prodomImg

pubmed

17

599

S=1976 I=63 E=0

Thiamine biosynthesis protein thiC

Pubmed 18524787

 

prodomImg

pubmed

184

623

S=1925 I=76 E=0

Thiamine biosynthesis protein thiC

Pubmed 9370266,9202460

 

prodomImg

pubmed

9

169

S=383 I=48 E=2.06554e-37

Thiamine biosynthesis protein thiC

Pubmed 9370266,9202460

 

prodomImg

pubmed

141

625

S=1889 I=70 E=0

Predicted thiamine biosynthesis protein ThiC

Pubmed 16008504

 

prodomImg

pubmed

24

590

S=1842 I=62 E=0

Thiamine biosynthesis protein thiC

Pubmed 15618402

 

prodomImg

sp_Pdown

sp|Q8PH13|THIC_XANAC

1

625

S=3216 I=96 E=0

Thiamine biosynthesis protein thiC

sp_Pdown

sp|Q3BPK7|THIC_XANC5

1

625

S=3202 I=95 E=0

Thiamine biosynthesis protein thiC

sp_Pdown

sp|Q5H4C0|THIC_XANOR

1

623

S=3177 I=95 E=0

Thiamine biosynthesis protein thiC

sp_Pdown

sp|B2SNG3|THIC_XANOP

1

623

S=3177 I=95 E=0

Thiamine biosynthesis protein thiC

sp_Pdown

sp|Q2P755|THIC_XANOM

1

623

S=3177 I=95 E=0

Thiamine biosynthesis protein thiC

Iprscan IPR002817 [MF_00089]

138

592

Thiamine biosynthesis protein ThiC

Iprscan IPR002817 [PF01964]

139

589

Thiamine biosynthesis protein ThiC

Iprscan IPR002817 [TIGR00190]

138

590

Thiamine biosynthesis protein ThiC

Iprscan [seg]

101

112

-

Iprscan [seg]

402

411

-

PDA1F7E2

186

430

S=1093 I=81 E=7.92973e-125

PD007048

431

622

S=825 I=73 E=2.16003e-92

PD018221

10

99

S=250 I=60 E=1.22873e-22

PD691489

141

178

S=133 I=67 E=1.70629e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one M5s1rjDk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr12000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr12000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr12000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr12000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
thiE XFF4834R_chr12290
XFF4834R_chr12280
XFF4834R_chr12280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr12300
XFF4834R_chr12300
ID thiE
AC XFF4834R_chr12290
LT XFF4834R_chr12290
OR XFF4834R_chr from 1396131 to 1396748 on strand -
DE probable thiamine-phosphate pyrophosphorylase
IP Aldolase-type TIM barrel
CL 1.5.3.8 Thiamine (Vitamin B1) GO:0009228
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: thiamin biosynthetic process (GO:0009228)
Molecular Function: thiamin-phosphate diphosphorylase activity (GO:0004789)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100331)
MW 21337.1 Da
SQ 205 aa
 
........10........20........30........40........50
| | | | |
MPNRLNVRGVYLITPDEPNTQRLLLRTAPLLGSITWLQYRNKQADAALRM
RQAGALREACAAHGVPLIINDDAQLAAQVGAQGVHLGEDDGDVAAARALL
GRQAIIGVSCYDDIERARAAAKAGASYVAFGAFFPTTTKQTTRRATPALL
QQAAGLDLPRVAIGGIAPAQVPALASAGADLIAVVSGVYAAPDPVAAVQA
YRDGF
XFF4834R

NP_643722.1 lcl|thiE-XAC3415

1

205

S=742 I=75 E=4.30048e-83

thiamine-phosphate pyrophosphorylase

XFF4834R

YP_365263.1 lcl|thiE-XCV3532

1

205

S=722 I=74 E=1.25468e-80

thiamine-phosphate pyrophosphorylase

XFF4834R

NP_638615.1 lcl|thiE-XCC3269

1

205

S=599 I=63 E=8.22481e-66

thiamine-phosphate pyrophosphorylase

XFF4834R

lcl|thiE-XALc_0778

8

205

S=449 I=51 E=1.46582e-47

probable thiamine-phosphate pyrophosphorylase protein

pubmed

7

193

S=247 I=38 E=1.52189e-21

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

Pubmed 19077236

 

prodomImg

pubmed

3

205

S=163 I=25 E=2.12046e-11

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

Pubmed 17563350

 

prodomImg

pubmed

30

203

S=152 I=27 E=4.64358e-10

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

Pubmed 7934828

 

prodomImg

pubmed

30

116

S=147 I=38 E=1.92333e-09

Probable thiamine biosynthetic bifunctional enzyme EC=2.5.1.3 EC=2.7.1.50 ; ATP-binding Kinase Magnesium Metal-binding Multifunctional Nucleotide

Pubmed 7961415

 

prodomImg

pubmed

10

199

S=147 I=28 E=2.04437e-09

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

Pubmed 16820047

 

prodomImg

pubmed

32

202

S=138 I=29 E=2.17121e-08

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

Pubmed 16857943

 

prodomImg

pubmed

28

189

S=123 I=27 E=1.59753e-06

BTH1

Pubmed 9700068

 

prodomImg

pubmed

10

109

S=109 I=30 E=8.0092e-05

Thiamine biosynthetic bifunctional enzyme EC=2.5.1.3 EC=2.7.1.50 ; ATP-binding Kinase Magnesium Metal-binding Multifunctional Nucleotide-binding b

Pubmed 7982968

 

prodomImg

sp_Pdown

sp|Q8PH45|THIE_XANAC

1

205

S=742 I=75 E=1.05147e-81

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

sp_Pdown

sp|Q8P5R7|THIE_XANCP

1

205

S=599 I=63 E=2.01097e-64

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

sp_Pdown

sp|Q4UYA4|THIE_XANC8

1

205

S=599 I=63 E=2.01097e-64

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

sp_Pdown

sp|Q9PGC4|THIE_XYLFA

8

205

S=445 I=46 E=9.35138e-46

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

sp_Pdown

sp|Q87AX6|THIE_XYLFT

8

205

S=440 I=45 E=4.11701e-45

Thiamine-phosphate pyrophosphorylase EC=2.5.1.3 ; Magnesium Metal-binding biosynthesis Transferase

Iprscan IPR013785 [G3DSA:3.20.20.70]

8

203

Aldolase-type TIM barrel

Iprscan [PTHR20857:SF15]

8

202

-

Iprscan [PTHR20857]

8

202

-

Iprscan IPR003733 [PF02581]

10

188

Thiamine monophosphate synthase

Iprscan IPR003733 [TIGR00693]

9

201

Thiamine monophosphate synthase

Iprscan [seg]

73

84

-

Iprscan [seg]

117

132

-

Iprscan [seg]

135

148

-

PD149806

10

203

S=183 I=35 E=9.86422e-15

PD610212

1

42

S=169 I=76 E=5.58746e-13

Iprscan IPR003733 [SSF51391]

7

203

Thiamine monophosphate synthase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wUezu9NQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

133 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr12290.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr12290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr12290.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr12290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
thiG XFF4834R_chr13380
XFF4834R_chr13370
XFF4834R_chr13370
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13390
XFF4834R_chr13390
ID thiG
AC XFF4834R_chr13380
LT XFF4834R_chr13380
OR XFF4834R_chr from 1537019 to 1537813 on strand -
DE probable thiazole synthase
IP Thiazole biosynthesis
CL 1.5.3.8 Thiamine (Vitamin B1) GO:0009228
EC
GO InterPro
Biological Process: thiamin biosynthetic process (GO:0009228)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 28035.9 Da
SQ 264 aa
 
........10........20........30........40........50
| | | | |
MTNPAPSDALVIAGKHYRSRLLTGTGKFKDLDETRRATEAAAAEIVTVAI
RRVNIGQDPNAPNLLDVLPPERYTLLPNTAGCYTAEDAVRTCRLARELLD
GHNLTKLEVLGDEKTLYPDVVQTLKAAEQLVADGFEVMVYTSDDPILARR
LEDIGCVAVMPLAAPIGSGLGIQNKYNLLEIIENAKVPIIVDAGVGTASD
AAIAMELGCDGVLMNTAIAGARDPILMASAMRKAIEAGREAFLAGRIPRK
RYASASSPVDGVIG
Show or not Domain decomposition
 
XFF4834R

NP_643609.1 lcl|thiG-XAC3302

1

264

S=1237 I=91 E=6.4402e-143

thiazole synthase

XFF4834R

YP_365148.1 lcl|thiG-XCV3417

1

264

S=1225 I=90 E=1.56589e-141

thiazole synthase

XFF4834R

NP_638496.1 lcl|thiG-XCC3150

1

264

S=1199 I=89 E=2.77704e-138

thiazole synthase

XFF4834R

lcl|ThiG-XALc_2262

1

264

S=1132 I=83 E=3.5213e-130

putative thiazole biosynthesis protein

pubmed

7

263

S=778 I=62 E=1.09472e-85

Thiazole biosynthesis protein thiG ; Cytoplasm Flavoprotein FMN Thiamine

Pubmed 17965706

 

prodomImg

pubmed

10

262

S=618 I=51 E=2.24119e-66

Thiazole biosynthesis protein thiG ; Cytoplasm Flavoprotein FMN Thiamine

Pubmed 19014707

 

prodomImg

pubmed

10

261

S=590 I=49 E=5.39298e-63

Thiamin biosynthesis protein ; Chloroplast Plastid

Pubmed 19004808

 

prodomImg

pubmed

10

263

S=566 I=46 E=4.17765e-60

Thiazole biosynthesis protein thiG ; Chloroplast Flavoprotein FMN Plastid Thiamine

Pubmed 15638458

 

prodomImg

pubmed

8

262

S=564 I=47 E=8.17509e-60

Thiazole biosynthesis protein thiG ; Chloroplast Flavoprotein FMN Plastid Thiamine

Pubmed 17252281

 

prodomImg

pubmed

10

258

S=553 I=46 E=1.87003e-58

Thiazole biosynthesis protein thiG ; Chloroplast Flavoprotein FMN Plastid Thiamine

Pubmed 11040290

 

prodomImg

pubmed

8

262

S=543 I=45 E=2.83947e-57

Thiazole biosynthesis protein thiG ; Chloroplast Flavoprotein FMN Plastid Thiamine

Pubmed 17252281

 

prodomImg

pubmed

8

262

S=541 I=46 E=4.7082e-57

Thiazole biosynthesis protein thiG ; Chloroplast Flavoprotein FMN Plastid Thiamine

Pubmed 16303746

 

prodomImg

pubmed

75

262

S=514 I=58 E=8.87527e-54

Thiazole biosynthesis protein thiG ; Cytoplasm Flavoprotein FMN Thiamine

Pubmed 18367281

 

prodomImg

pubmed

10

263

S=504 I=46 E=1.33593e-52

Thiazole biosynthesis protein thiG ; Cytoplasm Flavoprotein FMN Thiamine

Pubmed 8432721,8265357

 

prodomImg

sp_Pdown

sp|Q8PHF5|THIG_XANAC

1

264

S=1237 I=91 E=1.64566e-141

Thiazole biosynthesis protein thiG ; Cytoplasm Flavoprotein FMN Thiamine

sp_Pdown

sp|Q3BQ15|THIG_XANC5

1

264

S=1225 I=90 E=4.00129e-140

Thiazole biosynthesis protein thiG ; Cytoplasm Flavoprotein FMN Thiamine

sp_Pdown

sp|Q5GXE5|THIG_XANOR

1

264

S=1203 I=88 E=2.34496e-137

Thiazole biosynthesis protein thiG ; Cytoplasm Flavoprotein FMN Thiamine

sp_Pdown

sp|B2SWK7|THIG_XANOP

1

264

S=1203 I=88 E=2.34496e-137

Thiazole biosynthesis protein thiG ; Cytoplasm Flavoprotein FMN Thiamine

sp_Pdown

sp|Q2P0J5|THIG_XANOM

1

264

S=1203 I=88 E=2.34496e-137

Thiazole biosynthesis protein thiG ; Cytoplasm Flavoprotein FMN Thiamine

Iprscan IPR013785 [G3DSA:3.20.20.70]

7

261

Aldolase-type TIM barrel

Iprscan IPR008867 [PF05690]

12

258

Thiazole biosynthesis

Iprscan [seg]

33

53

-

PD006798

17

252

S=674 I=58 E=3.24147e-74

Iprscan IPR008867 [SSF110399]

9

252

Thiazole biosynthesis

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one qaPrq73V)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

357 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr13380.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr13380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr13380.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr13380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
thiS XFF4834R_chr13390
XFF4834R_chr13380
XFF4834R_chr13380
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13400
XFF4834R_chr13400
ID thiS
AC XFF4834R_chr13390
LT XFF4834R_chr13390
OR XFF4834R_chr from 1537863 to 1538063 on strand -
DE probable sulphur carrier protein ThiS
IP ThiamineS; ThiS, thiamine-biosynthesis; Beta-grasp fold, ferredoxin-type
CL 1.5.3.8 Thiamine (Vitamin B1) GO:0009228
EC
GO InterPro
Biological Process: sulfur metabolic process (GO:0006790)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 7039 Da
SQ 66 aa
 
........10........20........30........40........50
| | | | |
MNIQLNGTPRALPDNLPLAALLEQEGLAQRRVAVEVNGEIVPRGRHAEHA
LREGDVVEIVHALGGG
Show or not Domain decomposition
 
XFF4834R

NP_643608.1 lcl|XAC3301-XAC3301

1

66

S=197 I=67 E=7.6221e-18

sulfur carrier protein ThiS

XFF4834R

YP_365147.1 lcl|thiS-XCV3416

1

66

S=197 I=67 E=8.17273e-18

sulfur carrier protein ThiS

XFF4834R

NP_638495.1 lcl|XCC3149

1

66

S=179 I=64 E=1.05063e-15

sulfur carrier protein ThiS

XFF4834R

lcl|ThiS-XALc_2261

1

66

S=142 I=52 E=3.11396e-11

putative sulfur carrier protein involved in thiamine biosynthesis

Iprscan IPR012675 [G3DSA:3.10.20.30]

1

66

Beta-grasp fold, ferredoxin-type

Iprscan IPR003749 [PF02597]

3

66

ThiamineS

Iprscan IPR010035 [TIGR01683]

3

66

ThiS, thiamine-biosynthesis

Iprscan [seg]

9

29

-

PD019429

30

66

S=133 I=70 E=1.19576e-08

PD737892

30

66

S=104 I=54 E=3.7703e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one npz6utRc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr13390.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr13390.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr13390.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr13390.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
apbE XFF4834R_chr16920
XFF4834R_chr16910
XFF4834R_chr16910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16930
XFF4834R_chr16930
ID apbE
AC XFF4834R_chr16920
LT XFF4834R_chr16920
OR XFF4834R_chr from 1943217 to 1944143 on strand -
DE putative thiamine biosynthesis lipoprotein ApbE
IP ApbE-like lipoprotein
CL 1.5.3.8 Thiamine (Vitamin B1) GO:0009228
EC
GO InterPro
Biological Process: thiamin biosynthetic process (GO:0009228)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100408)
MW 32747.9 Da
SQ 308 aa
 
........10........20........30........40........50
| | | | |
MGTTWSVKLVAPRGRDLHPLHACIQAALDRVVQQMSTWEPESDISCYNRA
RAGHWQTLPVEFHTVLRAALDIAQASGGAFDPTIGPMVELWGFGASGGRR
RVPTREQIGLAGLRCGWQRLDLHGMRVLQPGAVALDLSGIAKGFGVDCVH
HALVQAGIASALIEVGGELFGYGRKPDGSAWRVLVESAPDEDAGAALPAR
VLALDGLAVATSGDRWHRFDADGIRYAHTFDPRTGVPVPHAPAAVTVLAH
DAMHADAWATAMTVLGVDDGLAHARTAHLAVRFLSRNNGALHESMSPAFE
QHLAASCA
XFF4834R

YP_364822.1 lcl|apbE-XCV3091

1

306

S=1252 I=80 E=1.25349e-144

thiamine biosynthesis protein

XFF4834R

NP_643256.1 lcl|apbE-XAC2947

1

306

S=1242 I=80 E=1.91999e-143

thiamine biosynthesis lipoprotein ApbE precursor

XFF4834R

NP_638126.1 lcl|apbE-XCC2778

1

306

S=1181 I=77 E=4.80983e-136

thiamine biosynthesis lipoprotein ApbE precursor

pubmed

1

305

S=359 I=31 E=6.99079e-35

Thiamine biosynthesis lipoprotein apbE ; Cell membrane Palmitate Signal

Pubmed 9473043

 

prodomImg

pubmed

1

306

S=307 I=25 E=1.25844e-28

Putative thiamine biosynthesis protein apbE ; Signal

Pubmed 9688822

 

prodomImg

pubmed

24

266

S=240 I=33 E=1.66681e-20

NosX ; Plasmid

Pubmed 9274035

 

prodomImg

pubmed

23

261

S=236 I=35 E=5.64932e-20

NosX protein

Pubmed 10960107

 

prodomImg

pubmed

1

303

S=219 I=31 E=6.1537e-18

Putative uncharacterized protein

Pubmed 14583260

 

prodomImg

pubmed

38

269

S=189 I=33 E=2.56469e-14

Nitrogen fixation protein rnfF ; Cell membrane Transmembrane

Pubmed 8264535,2071578

 

prodomImg

pubmed

1

269

S=163 I=26 E=3.85401e-11

Putative thiamine biosynthesis lipoprotein ; Plasmid

Pubmed 17464081

 

prodomImg

pubmed

35

261

S=157 I=25 E=2.4048e-10

NADH-dependent fumarate reductase ; FAD Flavoprotein

Pubmed 12138089

 

prodomImg

pubmed

35

261

S=156 I=25 E=2.6011e-10

Mitochondrial NADH-dependent fumarate reductase EC=1.3.1.6 ; FAD Flavoprotein Oxidoreductase

Pubmed 15718239

 

prodomImg

pubmed

24

189

S=139 I=27 E=3.09145e-08

Mitochondrial NADH-dependent fumarate reductase EC=1.3.1.6 ; FAD Flavoprotein Oxidoreductase

Pubmed 15718239

 

prodomImg

sp_Pdown

sp|P44550|APBE_HAEIN

1

301

S=403 I=33 E=2.14912e-40

Thiamine biosynthesis lipoprotein apbE ; Cell membrane Palmitate Signal

sp_Pdown

sp|P41780|APBE_SALTY

1

305

S=359 I=31 E=4.81494e-35

Thiamine biosynthesis lipoprotein apbE ; Cell membrane Palmitate Signal

sp_Pdown

sp|P0AB85|APBE_ECOLI

1

305

S=357 I=30 E=8.86434e-35

Thiamine biosynthesis lipoprotein apbE ; Cell membrane Palmitate Signal

sp_Pdown

sp|P0AB86|APBE_ECO57

1

305

S=357 I=30 E=8.86434e-35

Thiamine biosynthesis lipoprotein apbE ; Cell membrane Palmitate Signal

sp_Pdown

sp|Q89AP6|APBE_BUCBP

1

303

S=317 I=26 E=5.65876e-30

Probable thiamine biosynthesis protein apbE ; Signal

Iprscan IPR003374 [PF02424]

28

284

ApbE-like lipoprotein

Iprscan [seg]

236

245

-

PDA034D5

24

112

S=188 I=46 E=2.35663e-15

PD292669

116

190

S=163 I=44 E=3.10722e-12

PD009949

201

286

S=155 I=43 E=2.5405e-11

PDA1W8F8

1

27

S=143 I=100 E=7.35378e-10

PDA2I770

270

306

S=137 I=76 E=3.78768e-09

PDA1S672

1

25

S=103 I=80 E=5.03359e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one joDyitAM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr16920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr16920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr16920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr16920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
sufS XFF4834R_chr17010
XFF4834R_chr17000
XFF4834R_chr17000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17020
XFF4834R_chr17020
ID sufS
AC XFF4834R_chr17010
LT XFF4834R_chr17010
OR XFF4834R_chr from 1951721 to 1952965 on strand -
DE cysteine desulfurase
IP Aminotransferase, class V/Cysteine desulfurase; Cysteine desulfurase, SufS; Pyridoxal phosphate-dependent transferase, major region, subdomain 1; Aminotransferase class-V pyridoxal-phosphate binding site
CL 1.5.3.8 Thiamine (Vitamin B1) GO:0009228
EC
GO InterPro
Biological Process: cysteine metabolic process (GO:0006534)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: cysteine desulfurase activity (GO:0031071)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110310)
MW 45004.1 Da
SQ 414 aa
 
........10........20........30........40........50
| | | | |
MNVSAVPPSATPDWDRVRLEFPLLMRQVHGKPLIYFDNANTGQKPLQVIA
ATDEFYRRQNANVSRAVHALGSEATDAFEGARNKLARFLNVRADELVLCS
GTTFAINLVAYSWALPRLGAGDVILISRMEHHANIVPWQLVAQRTGATIR
VADITPDGALDLDGLRKAMTPDVKLLAITHVSNVLGTVNPVREICREARK
RGIVTMVDGSQAAPHRRIDVAGIGCDFYAITGHKMCGPTGTGALWARREH
LQAMPPFLGGGEMIKEVSFENTVFNDAPHKFEAGTPNIAGFVGLGAAVDY
LESIGLAHVEAREAELLAHFTEELQRIDGLRIFGTTPDKAAVVSFLIDGA
HAHDLATLLDLEGVAVRSGQHCAHPLLQYYGVAATCRASLAFYNTHDEIE
RFVAALVKVRRLLG
XFF4834R

XFF4834R_chr00700 lcl|XFF4834R_chr00700474_0083655_f1_XFF4834R-XFF4834R_chr00700

78

245

S=97 I=24 E=4.30131e-05

XFF4834R

NP_643247.1 lcl|nifS-XAC2938

1

414

S=2105 I=96 E=0

cysteine desulfurase

XFF4834R

YP_364813.1 lcl|XCV3082

1

414

S=2074 I=94 E=0

cysteine desulfurase

XFF4834R

NP_638117.1 lcl|nifS-XCC2769

1

414

S=1982 I=90 E=0

cysteine desulfurase

XFF4834R

lcl|sufS-XALc_1027

1

414

S=1737 I=81 E=0

probable cysteine desulphurase protein

XFF4834R

NP_635792.1 lcl|nifS-XCC0398

78

341

S=182 I=28 E=8.41624e-15

isopenicillin N epimerase

XFF4834R

NP_636586.1 lcl|nifS-XCC1212

54

317

S=160 I=28 E=3.60362e-12

isopenicillin N epimerase

XFF4834R

YP_361899.1 lcl|XCV0168

78

245

S=110 I=26 E=3.55448e-06

putative secreted protein

XFF4834R

NP_636924.2 lcl|XCC1553

30

322

S=99 I=20 E=8.13077e-05

kynureninase

pubmed

12

406

S=1032 I=49 E=2.85832e-116

Cysteine desulfurase SufS; FeS assembly protein SufS Pyridoxal phosphate Transferase

Pubmed 14761990

 

prodomImg

pubmed

15

414

S=973 I=47 E=4.55034e-109

Cysteine desulfurase EC=2.8.1.7 EC=4.4.1.16 ; Cytoplasm Lyase Pyridoxal phosphate Transferase

Pubmed 10329673

 

prodomImg

pubmed

13

410

S=965 I=46 E=3.95455e-108

ANL36 Cysteine desulfurase EC=2.8.1.7 ; Plasmid Pyridoxal phosphate Transferase

Pubmed 18353436

 

prodomImg

pubmed

15

414

S=943 I=46 E=1.64952e-105

Cysteine desulfurase EC=2.8.1.7 EC=4.4.1.16 ; Cytoplasm Lyase Pyridoxal phosphate Transferase

Pubmed 11251816,12876288

 

prodomImg

pubmed

13

414

S=917 I=42 E=2.63477e-102

Probable cysteine desulfurase EC=2.8.1.7 ; Pyridoxal phosphate Transferase

Pubmed 15590099

 

prodomImg

pubmed

16

406

S=900 I=44 E=3.05061e-100

Cysteine desulfurase 2, chloroplastic EC=2.8.1.7 EC=4.4.1.16 ; Lyase Plastid Pyridoxal phosphate Transferase Transit peptide

Pubmed 12033984,12427997

 

prodomImg

pubmed

10

413

S=886 I=41 E=1.38956e-98

Cysteine desulfurase EC=2.8.1.7 ; Lyase Pyridoxal phosphate Transferase

Pubmed 15006820

 

prodomImg

pubmed

13

413

S=849 I=41 E=4.98933e-94

Cysteine desulfurase EC=2.8.1.7 ; Pyridoxal phosphate Transferase

Pubmed 15066816

 

prodomImg

pubmed

16

413

S=816 I=40 E=4.03381e-90

Cysteine desulfurase ; Pyridoxal phosphate Transferase

Pubmed 17322329

 

prodomImg

pubmed

15

414

S=809 I=42 E=3.10282e-89

Selenocysteine lyase Aminotransferase-like protein Cg1761 CYSTEINE DESULFHYDRASE / SELENOCYSTEINE LYASE EC=4.4.1.- ; Pyridoxal phosphate

Pubmed 12948641

 

prodomImg

sp_Pdown

sp|Q9PDA6|CSD_XYLFA

1

414

S=1704 I=75 E=0

Probable cysteine desulfurase EC=2.8.1.7 ; Pyridoxal phosphate Transferase

sp_Pdown

sp|Q87DJ2|CSD_XYLFT

1

414

S=1696 I=74 E=0

Probable cysteine desulfurase EC=2.8.1.7 ; Pyridoxal phosphate Transferase

Iprscan IPR015421 [G3DSA:3.40.640.10]

47

304

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan IPR000192 [PF00266]

34

402

Aminotransferase, class V/Cysteine desulfurase

Iprscan IPR010970 [TIGR01979]

15

414

Cysteine desulfurase, SufS

Iprscan IPR020578 [PS00595]

225

244

Aminotransferase class-V pyridoxal-phosphate binding site

Iprscan [seg]

350

361

-

PD186234

262

326

S=226 I=63 E=6.43378e-20

PDA1U8P5

76

108

S=163 I=97 E=2.51425e-12

PD265450

25

75

S=156 I=59 E=1.83541e-11

PDA280Y6

1

26

S=132 I=88 E=1.49815e-08

PD948147

118

194

S=129 I=40 E=3.31228e-08

PDA1F7F0

105

138

S=124 I=68 E=1.75125e-07

PDA201N1

76

109

S=110 I=65 E=6.70051e-06

PD820769

320

378

S=110 I=41 E=7.12219e-06

PD899104

115

200

S=108 I=33 E=1.29982e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one y2Sz1kN8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

104 hits
swiss-prot

Swiss-Prot ncbi-blastp

258 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr17010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr17010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr17010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBD8Kqts/XFF4834R_chr17010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
nudJ XFF4834R_chr21010
XFF4834R_chr21000
XFF4834R_chr21000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21020
XFF4834R_chr21020
ID nudJ
AC XFF4834R_chr21010
LT XFF4834R_chr21010
OR XFF4834R_chr from 2434404 to 2434862 on strand -
DE probable bifunctional thiamin pyrimidine pyrophosphate hydrolase/ thiamin pyrophosphate hydrolase
IP NUDIX hydrolase domain-like
CL 1.5.3.8 Thiamine (Vitamin B1) GO:0009228
EC
GO InterPro
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN ds genprotec nudJ n existe pas, il faut passe par ecogene: blastp 45% sur 90%, on trouve ancien nom ymfB chez genP, publi thiamin biosynthesis
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100906)
MW 17138.3 Da
SQ 152 aa
 
........10........20........30........40........50
| | | | |
MSATEQRWHPDVTVATVVVRDGRFLQVEEAIGGRLLLNQPAGHLEPDESL
LDAAVRETLEETGWDVRLTQFIGTYQWVAPNGQCFLRFAFVADALTHHPD
RSLDTGVVRALWMTPDELRASTERLRSPLVWEVVADYLAGQRHPLALVRR
VA
XFF4834R

NP_642325.1 mutT-XAC1999

1

152

S=764 I=97 E=4.96278e-86

7,8-dihydro-8-oxoguanine-triphosphatase

XFF4834R

YP_363778.1 XCV2047

1

152

S=744 I=94 E=1.67923e-83

NUDIX hydrolase family protein

XFF4834R

NP_637330.1 mutT-XCC1965

1

152

S=723 I=91 E=5.20752e-81

7, 8-dihydro-8-oxoguanine-triphosphatase

XFF4834R

XALc_1443 XALc_1443

1

152

S=554 I=70 E=1.66171e-60

putative nudix hydrolase family protein

pubmed

13

117

S=112 I=36 E=1.88968e-05

ADP-ribose pyrophosphatase ; Hydrolase

Pubmed 15210687

 

prodomImg

sp_Pdown

sp|Q3Z2Y5|NUDJ_SHISS

10

148

S=299 I=47 E=2.63036e-28

Phosphatase nudJ EC=3.6.1.- ; Hydrolase Magnesium

sp_Pdown

sp|Q31ZL0|NUDJ_SHIBS

10

148

S=299 I=47 E=2.63036e-28

Phosphatase nudJ EC=3.6.1.- ; Hydrolase Magnesium

sp_Pdown

sp|P0AEI9|NUDJ_SHIFL

10

148

S=299 I=45 E=3.21444e-28

Phosphatase nudJ EC=3.6.1.- ; Hydrolase Magnesium

sp_Pdown

sp|Q0T5N8|NUDJ_SHIF8

10

148

S=299 I=45 E=3.21444e-28

Phosphatase nudJ EC=3.6.1.- ; Hydrolase Magnesium

sp_Pdown

sp|Q32EZ2|NUDJ_SHIDS

10

148

S=299 I=45 E=3.21444e-28

Phosphatase nudJ EC=3.6.1.- ; Hydrolase Magnesium

Iprscan IPR000086 [G3DSA:3.90.79.10]

12

120

NUDIX hydrolase domain

Iprscan [PTHR22769]

14

118

-

Iprscan IPR000086 [PF00293]

15

120

NUDIX hydrolase domain

Iprscan IPR020084 [PS00893]

42

63

NUDIX hydrolase, conserved site

PD337037

61

149

S=275 I=58 E=8.2205e-26

Iprscan IPR015797 [SSF55811]

1

145

NUDIX hydrolase domain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL