Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr14070nadEXFF4834R_chr14070putative glutamine-dependent NAD(+) synthetase
  2. XFF4834R_chr18540nadDXFF4834R_chr18540putative nicotinate-nucleotide adenylyltransferase
  3. XFF4834R_chr26770nadCXFF4834R_chr26770probable nicotinate-nucleotide pyrophosphorylase
  4. XFF4834R_chr29180XFF4834R_chr31710862_3354638_r2_XFF4834R-XFF4834R_chr29180XFF4834R_chr29180putative inorganic polyphosphate/ATP-NAD kinase

nadE XFF4834R_chr14070
XFF4834R_chr14060
XFF4834R_chr14060
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14080
XFF4834R_chr14080
ID nadE
AC XFF4834R_chr14070
LT XFF4834R_chr14070
OR XFF4834R_chr from 1608653 to 1610293 on strand +
DE putative glutamine-dependent NAD(+) synthetase
IP Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase; Rossmann-like alpha/beta/alpha sandwich fold
CL 1.5.3.7 Nicotinamide adenine dinucleotide (NAD) GO:0009435
EC
GO InterPro
Biological Process: nitrogen compound metabolic process (GO:0006807)
Biological Process: NAD biosynthetic process (GO:0009435)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: NAD+ synthase (glutamine-hydrolyzing) activity (GO:0003952)
acting on carbon-nitrogen (but not peptide) bonds (GO:0016810)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 59307.4 Da
SQ 546 aa
 
........10........20........30........40........50
| | | | |
MSQTLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFEADIVLFPELAIS
GYPPEDLLLRPGFLAHCEQALARIAAATHGIVAVVGWPQSAGSVVYNAAS
VLRDGRIEATYRKRELPNYAVFDERRYFDVDPDGENCVVTVKGVRVGVVI
CEDLWFAEPLANTVRAGAELVLVPNASPYERGKHAQRDALLAERTRESGA
AIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVDQWLVVDYAAGER
SFTPVVWVDDGDESMDALAWRAVVRGLQDYCRKNGFSKVWLGLSGGIDSA
LVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETIAIE
PAFEGLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTG
NKSEYAVGYATIYGDMCGGYAPLKDLYKTEVFGLAKWRNTVGGAPVIPPA
VISRPPSAELRDNQTDQDSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAA
DTVEHVLRLVRLNEWKRHQSALGPKVSRRAFGRERRYPITNGYRGQ
XFF4834R

XFF4834R_chr23070 lcl|XFF4834R_chr25200183_2671109_f3_XFF4834R-XFF4834R_chr23070

76

176

S=108 I=32 E=2.46165e-06

XFF4834R

XFF4834R_chr23070 lcl|XFF4834R_chr25200183_2671109_f3_XFF4834R-XFF4834R_chr23070

76

176

S=108 I=32 E=2.46165e-06

XFF4834R

NP_643528.1 lcl|nadE-XAC3220

1

546

S=2776 I=97 E=0

NAD synthetase

XFF4834R

YP_365076.1 lcl|nadE-XCV3345

2

546

S=2750 I=97 E=0

NAD synthetase

XFF4834R

NP_638438.1 lcl|nadE-XCC3091

2

546

S=2688 I=94 E=0

NAD synthetase

XFF4834R

lcl|XALc_0688

1

544

S=2334 I=81 E=0

putative nad(+) synthase (glutamine-hydrolyzing) protein

XFF4834R

NP_637555.1 lcl|XCC2199

76

176

S=108 I=33 E=9.98077e-06

beta-alanine synthetase

XFF4834R

YP_364232.1 lcl|XCV2501

76

211

S=107 I=29 E=1.18821e-05

putative carbon-nitrogen hyrolase family protein

XFF4834R

NP_642620.1 lcl|XAC2303-XAC2303

76

176

S=107 I=32 E=1.41457e-05

beta-alanine synthetase

pubmed

1

546

S=1124 I=48 E=2.7711e-127

Glutamine-dependent NAD(+) synthetase EC=6.3.5.1 ; ATP-binding Ligase Nucleotide-binding

Pubmed 8431308,8195100

 

prodomImg

pubmed

55

544

S=819 I=42 E=2.33695e-90

NAD(+) synthase (Glutamine-hydrolysing) EC=6.3.5.1 ; ATP-binding Ligase Nucleotide-binding

Pubmed 10517584

 

prodomImg

pubmed

291

480

S=227 I=31 E=1.52582e-18

NH(3)-dependent NAD(+) synthetase EC=6.3.1.5 ; ATP-binding Ligase Nucleotide-binding

Pubmed 18263572

 

prodomImg

pubmed

273

482

S=195 I=31 E=1.12079e-14

NH(3)-dependent NAD(+) synthetase EC=6.3.1.5 ; ATP-binding Ligase Nucleotide-binding

Pubmed 7476192

 

prodomImg

pubmed

271

517

S=188 I=33 E=8.54636e-14

NH(3)-dependent NAD(+) synthetase EC=6.3.1.5 ; ATP-binding Ligase Nucleotide-binding

Pubmed 17350933

 

prodomImg

pubmed

282

494

S=177 I=33 E=1.67101e-12

NH(3)-dependent NAD(+) synthetase EC=6.3.1.5 ; ATP-binding Ligase Nucleotide-binding

Pubmed 12466555

 

prodomImg

pubmed

269

422

S=158 I=35 E=2.91468e-10

Putative NH3-dependent NAD synthetase ; ATP-binding Ligase Nucleotide-binding

Pubmed 11390676

 

prodomImg

pubmed

7

229

S=143 I=26 E=2.24011e-08

UPF0012 hydrolase mtnU EC=3.5.-.-

Pubmed 12022921

 

prodomImg

pubmed

277

485

S=139 I=28 E=5.99991e-08

NH(3)-dependent NAD(+) synthetase EC=6.3.1.5 ; ATP-binding Ligase Nucleotide-binding

Pubmed 15590099

 

prodomImg

pubmed

277

485

S=136 I=29 E=1.55194e-07

NH(3)-dependent NAD(+) synthetase EC=6.3.1.5 ; ATP-binding Ligase Nucleotide-binding

Pubmed 12547821,12777395

 

prodomImg

sp_Pdown

sp|Q9PC24|NADE_XYLFA

1

545

S=2286 I=79 E=0

Probable glutamine-dependent NAD(+) synthetase EC=6.3.5.1 ; ATP-binding Ligase Nucleotide-binding

sp_Pdown

sp|Q87D47|NADE_XYLFT

1

545

S=2283 I=79 E=0

Probable glutamine-dependent NAD(+) synthetase EC=6.3.5.1 ; ATP-binding Ligase Nucleotide-binding

sp_Pdown

sp|Q03638|NADE_RHOCA

1

546

S=1124 I=48 E=1.90709e-127

Glutamine-dependent NAD(+) synthetase EC=6.3.5.1 ; ATP-binding Ligase Nucleotide-binding

sp_Pdown

sp|P74292|NADE_SYNY3

7

546

S=970 I=40 E=1.00196e-108

Probable glutamine-dependent NAD(+) synthetase EC=6.3.5.1 ; ATP-binding Ligase Nucleotide-binding

sp_Pdown

sp|Q9X0Y0|NADE2_THEMA

270

544

S=739 I=52 E=8.66336e-81

Probable glutamine-dependent NAD(+) synthetase EC=6.3.5.1 ; ATP-binding Ligase Nucleotide-binding

Iprscan IPR003010 [G3DSA:3.60.110.10]

5

248

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan IPR014729 [G3DSA:3.40.50.620]

267

516

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan IPR014445 [PIRSF006630]

1

546

Glutamine-dependent NAD(+) synthetase, GAT domain-containing

Iprscan [PTHR23090:SF1]

9

541

-

Iprscan [PTHR23090]

9

541

-

Iprscan [PF02540]

270

519

-

Iprscan IPR003010 [PF00795]

20

175

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Iprscan IPR003694 [TIGR00552]

261

534

NAD+ synthase

Iprscan [seg]

138

149

-

PD688067

230

283

S=247 I=83 E=2.36147e-22

PD004581

368

448

S=213 I=52 E=2.95244e-18

PD930229

54

95

S=208 I=98 E=1.21226e-17

PDA1S6Q1

189

229

S=195 I=100 E=4.44039e-16

PD034322

267

359

S=173 I=50 E=1.80436e-13

PDA845Q4

150

209

S=151 I=45 E=8.50346e-11

PDA41536

483

543

S=151 I=61 E=1.00355e-10

PD468656

451

527

S=148 I=43 E=2.03351e-10

PDA41513

519

546

S=138 I=96 E=3.48856e-09

PD931347

5

88

S=135 I=43 E=7.31981e-09

Iprscan [SSF52402]

269

529

-

Iprscan IPR003010 [SSF56317]

2

244

Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gyarV1wJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

185 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr14070.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr14070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr14070.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr14070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
nadD XFF4834R_chr18540
XFF4834R_chr18530
XFF4834R_chr18530
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18550
XFF4834R_chr18550
ID nadD
AC XFF4834R_chr18540
LT XFF4834R_chr18540
OR XFF4834R_chr from 2119344 to 2120213 on strand +
DE putative nicotinate-nucleotide adenylyltransferase
IP Probable nicotinate-nucleotide adenylyltransferase; Rossmann-like alpha/beta/alpha sandwich fold
CL 1.5.3.7 Nicotinamide adenine dinucleotide (NAD) GO:0009435
EC
GO InterPro
Biological Process: NAD biosynthetic process (GO:0009435)
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: nucleotidyltransferase activity (GO:0016779)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100408)
MW 30637.2 Da
SQ 289 aa
 
........10........20........30........40........50
| | | | |
MKARDAGTRDPGPGSREGQGDRQRAHSDQLAQGSRAIGSSGSQEQQHSHP
DHVADPGSSDSRIPNPDSQLHLYYGGTFDPIHLGHLAIACAARDELGACV
RLVPAADPPHRPAPGATAAQRAQMLKLALANHPGLQLDTRELQRAAHCDA
PSYTVDTLRGLRAELGLAAPIAWLLGADAFIGLHHWHQWEALFGLAHFVV
AARPGTALALADAPQLAAAVQGRWVASADELVGAPAGRLYLLHQPLRGES
ASMVRSRIATGAQWQSLVPPPVAGMIQREGLYRSVRPAT
Hamap NADD_MF_00244 raw_score=2850 norm_score=27.050

Probable nicotinate-nucleotide adenylyltransferase [nadD].

XFF4834R

NP_643087.1 lcl|nadD-XAC2778

1

289

S=1218 I=84 E=1.37661e-140

nicotinic acid mononucleotide adenylyltransferase

XFF4834R

YP_364665.1 lcl|nadD-XCV2934

1

289

S=1152 I=81 E=1.61381e-132

nicotinic acid mononucleotide adenylyltransferase

XFF4834R

NP_637964.1 lcl|nadD-XCC2616

59

289

S=737 I=66 E=2.95067e-82

nicotinic acid mononucleotide adenylyltransferase

XFF4834R

lcl|nadD-XALc_2477

68

282

S=454 I=48 E=5.0549e-48

putative nicotinamide-nucleotide adenylyltransferase protein

pubmed

74

284

S=184 I=31 E=9.84079e-14

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

Pubmed 18482458

 

prodomImg

pubmed

75

203

S=139 I=28 E=2.53481e-08

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

Pubmed 15547252

 

prodomImg

pubmed

75

284

S=134 I=28 E=1.2499e-07

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

Pubmed 18192381

 

prodomImg

pubmed

75

205

S=133 I=31 E=1.55431e-07

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

Pubmed 17194220

 

prodomImg

pubmed

75

284

S=133 I=28 E=1.56792e-07

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

Pubmed 18192393

 

prodomImg

sp_Pdown

sp|B2FPR4|NADD_STRMK

69

287

S=594 I=55 E=1.64785e-63

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

sp_Pdown

sp|B0U379|NADD_XYLFM

70

282

S=436 I=46 E=2.20067e-44

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

sp_Pdown

sp|Q9PBG5|NADD_XYLFA

70

282

S=436 I=46 E=2.259e-44

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

sp_Pdown

sp|Q87C62|NADD_XYLFT

70

282

S=431 I=46 E=9.27532e-44

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

sp_Pdown

sp|B2I5T8|NADD_XYLF2

70

282

S=431 I=46 E=9.27532e-44

Probable nicotinate-nucleotide adenylyltransferase EC=2.7.7.18 ; ATP-binding NAD Nucleotide-binding Nucleotidyltransferase Pyridine biosynthesis

Iprscan IPR014729 [G3DSA:3.40.50.620]

67

283

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [MF_00244]

74

281

-

Iprscan IPR004820 [PF01467]

73

257

Cytidylyltransferase

Iprscan IPR004821 [TIGR00125]

71

134

Cytidyltransferase-related

Iprscan IPR005248 [TIGR00482]

73

282

Probable nicotinate-nucleotide adenylyltransferase

Iprscan [seg]

38

49

-

Iprscan [seg]

158

169

-

Iprscan [seg]

207

219

-

PD641580

1

73

S=289 I=81 E=1.52766e-27

PD641579

220

282

S=271 I=86 E=2.75921e-25

PD009578

108

205

S=182 I=39 E=1.3144e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nAVDcN91)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

268 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr18540.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr18540.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr18540.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr18540.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
nadC XFF4834R_chr26770
XFF4834R_chr26760
XFF4834R_chr26760
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr26780
XFF4834R_chr26780
ID nadC
AC XFF4834R_chr26770
LT XFF4834R_chr26770
OR XFF4834R_chr from 3088985 to 3089860 on strand +
DE probable nicotinate-nucleotide pyrophosphorylase
IP Quinolinate phosphoribosyl transferase; Nicotinate-nucleotide pyrophosphorylase; Aldolase-type TIM barrel
CL 1.5.3.7 Nicotinamide adenine dinucleotide (NAD) GO:0009435
EC
GO InterPro
Biological Process: NAD biosynthetic process (GO:0009435)
Biological Process: pyridine nucleotide biosynthetic process (GO:0019363)
Biological Process: metabolic process (GO:0008152)
Molecular Function: nicotinate-nucleotide diphosphorylase (carboxylating) activity (GO:0004514)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100409)
MW 31055.1 Da
SQ 291 aa
 
........10........20........30........40........50
| | | | |
MRTNVPDAPPVESIEADVARALAEDIGSGDVTAALLPDQADSAYLLCKQD
AVIAGRPWFDATHRALDPQVRIDWQVHEGQRVAAGTVLALLHGRSRSLVS
AERTSLNFMQTLSATATTTAAYVAAVAGTHARILDTRKTLPGLRAAQKYA
VRCGGGDNHRIGLFDTVMLKENHIRAAGSLSAAVHAARTQQPQLPLVVEV
ETLEQLREALQVGCTRILIDDFDQAMRREAVRIVGALPPERRIPLEVSGS
VDLAGIRTIAEAGVDCISIGGLTKHVQAVDLSLKLGPPPAR
Show or not Domain decomposition
 
XFF4834R

YP_364562.1 lcl|nadC-XCV2831

3

291

S=1249 I=85 E=2.31173e-144

nicotinate-nucleotide pyrophosphorylase

XFF4834R

NP_642992.1 lcl|nadC-XAC2681

5

291

S=1245 I=85 E=6.87466e-144

nicotinate-nucleotide pyrophosphorylase

XFF4834R

NP_637855.1 lcl|nadC-XCC2505

1

289

S=1143 I=79 E=1.80712e-131

nicotinate-nucleotide pyrophosphorylase

XFF4834R

lcl|nadC-XALc_1270

9

289

S=996 I=71 E=1.20245e-113

probable nicotinate-nucleotide pyrophosphorylase protein

pubmed

14

285

S=561 I=45 E=1.95256e-59

Nicotinate-nucleotide pyrophosphorylase [carboxylating] EC=2.4.2.19 ; Glycosyltransferase Pyridine biosynthesis

Pubmed 2430961

 

prodomImg

pubmed

17

285

S=556 I=46 E=9.05795e-59

Phthalate-inducible quinolinate phosphoribosyl transferase

Pubmed 9851995,10322007

 

prodomImg

pubmed

17

285

S=551 I=44 E=3.49895e-58

Quinolinate phosphoribosyl transferase

Pubmed 16391116

 

prodomImg

pubmed

10

285

S=537 I=42 E=1.98194e-56

NadC

Pubmed 15731039

 

prodomImg

pubmed

14

285

S=492 I=42 E=4.84492e-51

Nicotinate-nucleotide pyrophosphorylase [carboxylating] EC=2.4.2.19 ; Glycosyltransferase Pyridine biosynthesis

Pubmed 8419294

 

prodomImg

pubmed

18

285

S=457 I=43 E=8.88979e-47

Nicotinate-nucleotide pyrophosphorylase [carboxylating] EC=2.4.2.19 ; Glycosyltransferase Pyridine biosynthesis

Pubmed 7959070,8561507

 

prodomImg

pubmed

18

283

S=455 I=40 E=1.60832e-46

Nicotinate-nucleotide pyrophosphorylase EC=2.4.2.19 ; Glycosyltransferase

Pubmed 12446909

 

prodomImg

pubmed

6

285

S=413 I=36 E=1.97441e-41

Quinolinate phosphoribosyltransferase EC=2.4.2.19 ; Glycosyltransferase

Pubmed 11198422

 

prodomImg

pubmed

6

285

S=409 I=36 E=6.02711e-41

Quinolinate phosphoribosyltransferase EC=2.4.2.19 ; Glycosyltransferase

Pubmed 11198422

 

prodomImg

pubmed

1

290

S=407 I=38 E=1.08095e-40

Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] EC=2.4.2.19 ; Glycosyltransferase Pyridine biosynthesis

Pubmed 7721706

 

prodomImg

sp_Pdown

sp|P30819|NADC_PSEAE

14

285

S=561 I=45 E=1.34593e-59

Nicotinate-nucleotide pyrophosphorylase [carboxylating] EC=2.4.2.19 ; Glycosyltransferase Pyridine biosynthesis

sp_Pdown

sp|P30012|NADC_SALTY

14

285

S=492 I=42 E=3.33968e-51

Nicotinate-nucleotide pyrophosphorylase [carboxylating] EC=2.4.2.19 ; Glycosyltransferase Pyridine biosynthesis

sp_Pdown

sp|P30011|NADC_ECOLI

18

285

S=457 I=43 E=6.12788e-47

Nicotinate-nucleotide pyrophosphorylase [carboxylating] EC=2.4.2.19 ; Glycosyltransferase Pyridine biosynthesis

sp_Pdown

sp|P77938|NADC_RHORU

1

290

S=407 I=38 E=7.45115e-41

Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] EC=2.4.2.19 ; Glycosyltransferase Pyridine biosynthesis

sp_Pdown

sp|P74301|NADC_SYNY3

9

285

S=381 I=37 E=9.40527e-38

Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] EC=2.4.2.19 ; Glycosyltransferase Pyridine biosynthesis

Iprscan [G3DSA:3.90.1170.20]

20

117

-

Iprscan IPR013785 [G3DSA:3.20.20.70]

118

285

Aldolase-type TIM barrel

Iprscan IPR002638 [PF02749]

26

113

Quinolinate phosphoribosyl transferase

Iprscan IPR002638 [PF01729]

115

284

Quinolinate phosphoribosyl transferase

Iprscan IPR004393 [TIGR00078]

17

285

Nicotinate-nucleotide pyrophosphorylase

Iprscan [seg]

114

131

-

Iprscan [seg]

176

187

-

PD003988

132

285

S=278 I=41 E=3.95116e-26

PD037980

13

113

S=229 I=49 E=3.21705e-20

PDA5D5Z1

165

274

S=125 I=35 E=1.12759e-07

PDA3O382

256

291

S=109 I=58 E=1.04986e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9P8DfNU4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

23 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr26770.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr26770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr26770.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr26770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr31710862_3354638_r2_XFF4834R-XFF4834R_chr29180 XFF4834R_chr29180
XFF4834R_chr29170
XFF4834R_chr29170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29190
XFF4834R_chr29190
ID XFF4834R_chr31710862_3354638_r2_XFF4834R-XFF4834R_chr29180
AC XFF4834R_chr29180
LT XFF4834R_chr29180
OR XFF4834R_chr from 3353862 to 3354638 on strand -
DE putative inorganic polyphosphate/ATP-NAD kinase
IP ATP-NAD/AcoX kinase
CL 1.5.3.7 Nicotinamide adenine dinucleotide (NAD) GO:0009435
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: NAD+ kinase activity (GO:0003951)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 28453 Da
SQ 258 aa
 
........10........20........30........40........50
| | | | |
MTAPPRIAFLASPAELAVAARARLTQRYGDHALDSADIVCALGGDGFMLQ
TLHRHGASDKPVFGMKLGSVGFLMNQYRDNEDDLLERLQRAEPAYLRPLE
MQVHTESGASAGSLAYNEVSLLRQTRQAAHLSIDLNGQTRIAELIGDGVM
VATPAGSTAYNYSAHGPILPLGSHTLALTPIAPYRPRRWRGAILKADTEV
RFRVLDPYKRPVSVTADSHEIRDVVEVTIRESAQRQVTLLFDPEHNLEER
IFSEQFAV
XFF4834R

NP_641927.1 lcl|ppnK-XAC1595

1

258

S=1344 I=99 E=7.06287e-156

inorganic polyphosphate/ATP-NAD kinase

XFF4834R

YP_363367.1 lcl|ppnK-XCV1636

1

258

S=1334 I=98 E=9.65901e-155

inorganic polyphosphate/ATP-NAD kinase

XFF4834R

NP_636917.1 lcl|ppnK-XCC1546

1

258

S=1268 I=94 E=1.14225e-146

inorganic polyphosphate/ATP-NAD kinase

XFF4834R

lcl|ppnK-XALc_1760

5

258

S=1061 I=81 E=1.20997e-121

probable inorganic polyphosphate/atp-nad kinase (poly(p)/atp nad kinase) protein

pubmed

8

256

S=670 I=48 E=1.20639e-72

Predicted kinase ; ATP-binding Cytoplasm NAD NADP Nucleotide-binding Transferase

Pubmed 14566056

 

prodomImg

pubmed

6

256

S=661 I=53 E=1.66427e-71

Inorganic polyphosphate/ATP-NAD kinase ; ATP-binding Cytoplasm NADP Nucleotide-binding Transferase

Pubmed 18496576

 

prodomImg

pubmed

37

204

S=226 I=36 E=8.20783e-19

Probable inorganic polyphosphate/ATP-NAD kinase EC=2.7.1.23 ; ATP-binding Cytoplasm NADP Nucleotide-binding Transferase

Pubmed 18524787

 

prodomImg

pubmed

37

188

S=210 I=35 E=7.57573e-17

Probable inorganic polyphosphate/ATP-NAD kinase EC=2.7.1.23 ; ATP-binding Cytoplasm NADP Nucleotide-binding Transferase

Pubmed 19148287

 

prodomImg

pubmed

15

242

S=178 I=25 E=4.55362e-13

Probable inorganic polyphosphate/ATP-NAD kinase EC=2.7.1.23 ; ATP-binding Cytoplasm NADP Nucleotide-binding Transferase

Pubmed 18263572

 

prodomImg

sp_Pdown

sp|Q8PM39|PPNK_XANAC

1

258

S=1344 I=99 E=1.94711e-154

Probable inorganic polyphosphate/ATP-NAD kinase EC=2.7.1.23 ; ATP-binding Cytoplasm NADP Nucleotide-binding Transferase

sp_Pdown

sp|Q3BV46|PPNK_XANC5

1

258

S=1334 I=98 E=2.66282e-153

Probable inorganic polyphosphate/ATP-NAD kinase EC=2.7.1.23 ; ATP-binding Cytoplasm NADP Nucleotide-binding Transferase

sp_Pdown

sp|Q2P310|PPNK_XANOM

1

258

S=1310 I=97 E=2.13595e-150

Probable inorganic polyphosphate/ATP-NAD kinase EC=2.7.1.23 ; ATP-binding Cytoplasm NADP Nucleotide-binding Transferase

sp_Pdown

sp|Q8PAD9|PPNK_XANCP

1

258

S=1268 I=94 E=3.14899e-145

Probable inorganic polyphosphate/ATP-NAD kinase EC=2.7.1.23 ; ATP-binding Cytoplasm NADP Nucleotide-binding Transferase

sp_Pdown

sp|Q4UT86|PPNK_XANC8

1

258

S=1268 I=94 E=3.14899e-145

Probable inorganic polyphosphate/ATP-NAD kinase EC=2.7.1.23 ; ATP-binding Cytoplasm NADP Nucleotide-binding Transferase

Iprscan IPR017437 [G3DSA:2.60.200.30]

104

231

ATP-NAD kinase, PpnK-type, all-beta

Iprscan [MF_00361]

14

258

-

Iprscan IPR002504 [PTHR20275]

30

256

ATP-NAD/AcoX kinase

Iprscan IPR002504 [PF01513]

34

228

ATP-NAD/AcoX kinase

Iprscan [SignalP-NN(euk)]

1

19

-

PD872620

101

184

S=221 I=60 E=2.56092e-19

PD002781

34

210

S=207 I=31 E=1.3065e-17

PD638848

34

234

S=142 I=24 E=9.07742e-10

PDA7U757

185

255

S=142 I=35 E=9.39958e-10

PDA1Y9X4

1

30

S=140 I=97 E=1.88812e-09

PDA1N9X2

228

257

S=136 I=87 E=5.46994e-09

PDA1I5K9

33

99

S=131 I=39 E=1.9706e-08

PDA982V6

34

214

S=114 I=24 E=2.6927e-06

PDA1O0P1

218

256

S=113 I=49 E=3.52833e-06

PDA2O556

140

189

S=108 I=46 E=1.18548e-05

Iprscan IPR016064 [SSF111331]

28

243

ATP-NAD kinase, PpnK-type

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kvf4y984)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

512 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr29180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr29180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr29180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoIbGER/XFF4834R_chr29180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.