Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr00130pdxJXFF4834R_chr00130probable pyridoxal phosphate biosynthetic protein PdxJ
  2. XFF4834R_chr08680pdxAXFF4834R_chr08680probable 4-hydroxythreonine-4-phosphate dehydrogenase
  3. XFF4834R_chr16180pdxHXFF4834R_chr16180putative pyridoxine/pyridoxamine 5'-phosphate oxidase

pdxJ XFF4834R_chr00130
XFF4834R_chr_0016
XFF4834R_chr_0016
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00140
XFF4834R_chr00140
ID pdxJ
AC XFF4834R_chr00130
LT XFF4834R_chr00130
OR XFF4834R_chr from 14490 to 15257 on strand -
DE probable pyridoxal phosphate biosynthetic protein PdxJ
IP Pyridoxal phosphate (active vitamin B6) biosynthesis PdxJ; Aldolase-type TIM barrel
CL 1.5.3.6 Pyridoxine (vitamin B6) GO:0008615
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: pyridoxine biosynthetic process (GO:0008615)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100324)
MW 26535.4 Da
SQ 255 aa
 
........10........20........30........40........50
| | | | |
MTAQLSVNVNKIAVLRNSRGGADPDVAQAARACIAAGAHGITVHPRPDQR
HIRADDVLALSALTRTHAVEFNIEGNPFAPPRAGYPGLLELCRATRPQQI
TLVPDGDGQLTSDHGFDFAQDTAQLAELITAFKRLGSRVSLFVDAGNPDI
ARAATLGADRIELYTGPYAHAHAGGQADTALALFADAAQRASAAGLGINA
GHDLSQANLGDFLAAVPGVLEVSIGHALISEALYQGLDASVRAYVDILRS
SHVSA
Show or not Domain decomposition
 
pubmed

1

248

S=478 I=47 E=1.86777e-49

Pyridoxine 5'-phosphate synthase EC=2.6.99.2 ; Cytoplasm biosynthesis Transferase

Pubmed 18524787

 

prodomImg

pubmed

1

249

S=474 I=45 E=6.167e-49

Pyridoxine 5'-phosphate synthase EC=2.6.99.2 ; Cytoplasm biosynthesis Transferase

Pubmed 17107561

 

prodomImg

pubmed

40

172

S=281 I=48 E=1.31441e-25

GdpxJ protein

Pubmed 12949166

 

prodomImg

pubmed

40

172

S=281 I=48 E=1.56481e-25

GdpxJ protein

Pubmed 12949166

 

prodomImg

pubmed

40

172

S=281 I=48 E=1.57851e-25

GdpxJ protein

Pubmed 12949166

 

prodomImg

pubmed

4

243

S=281 I=33 E=1.64885e-25

Pyridoxine 5'-phosphate synthase EC=2.6.99.2 ; Cytoplasm biosynthesis Transferase

Pubmed 9870699

 

prodomImg

pubmed

40

172

S=280 I=48 E=1.84674e-25

GdpxJ protein

Pubmed 12949166

 

prodomImg

pubmed

5

241

S=280 I=34 E=1.94592e-25

Pyridoxine 5'-phosphate synthase EC=2.6.99.2 ; Cytoplasm biosynthesis Transferase

Pubmed 1537799,1537800

 

prodomImg

pubmed

40

172

S=280 I=48 E=1.98015e-25

GdpxJ protein

Pubmed 12949166

 

prodomImg

pubmed

40

172

S=280 I=48 E=2.03262e-25

GdpxJ protein

Pubmed 12949166

 

prodomImg

sp_Pdown

sp|Q3BZR9|PDXJ_XANC5

1

255

S=1084 I=85 E=5.63014e-123

Pyridoxine 5'-phosphate synthase EC=2.6.99.2 ; Cytoplasm biosynthesis Transferase

sp_Pdown

sp|Q8PRF1|PDXJ_XANAC

1

255

S=1075 I=84 E=6.63896e-122

Pyridoxine 5'-phosphate synthase EC=2.6.99.2 ; Cytoplasm biosynthesis Transferase

sp_Pdown

sp|Q2P9L0|PDXJ_XANOM

1

255

S=1043 I=81 E=4.58792e-118

Pyridoxine 5'-phosphate synthase EC=2.6.99.2 ; Cytoplasm biosynthesis Transferase

sp_Pdown

sp|Q5H704|PDXJ_XANOR

1

255

S=1040 I=80 E=1.20759e-117

Pyridoxine 5'-phosphate synthase EC=2.6.99.2 ; Cytoplasm biosynthesis Transferase

sp_Pdown

sp|B2SUX4|PDXJ_XANOP

1

255

S=1040 I=80 E=1.20759e-117

Pyridoxine 5'-phosphate synthase EC=2.6.99.2 ; Cytoplasm biosynthesis Transferase

Iprscan IPR013785 [G3DSA:3.20.20.70]

5

253

Aldolase-type TIM barrel

Iprscan IPR004569 [PF03740]

4

248

Pyridoxal phosphate (active vitamin B6) biosynthesis PdxJ

Iprscan IPR004569 [TIGR00559]

4

250

Pyridoxal phosphate (active vitamin B6) biosynthesis PdxJ

Iprscan [seg]

27

38

-

Iprscan [seg]

176

194

-

PD013657

9

251

S=303 I=34 E=2.7707e-29

Iprscan IPR004569 [SSF63892]

1

253

Pyridoxal phosphate (active vitamin B6) biosynthesis PdxJ

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5fGBK9WK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

23 hits
swiss-prot

Swiss-Prot ncbi-blastp

242 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr00130.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr00130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr00130.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr00130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pdxA XFF4834R_chr08680
XFF4834R_chr08670
XFF4834R_chr08670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08690
XFF4834R_chr08690
ID pdxA
AC XFF4834R_chr08680
LT XFF4834R_chr08680
OR XFF4834R_chr from 1007737 to 1008708 on strand -
DE probable 4-hydroxythreonine-4-phosphate dehydrogenase
IP Pyridoxal phosphate (active vitamin B6) biosynthesis PdxA
CL 1.5.3.6 Pyridoxine (vitamin B6) GO:0008615
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: pyridoxine biosynthetic process (GO:0008615)
Molecular Function: NAD or NADH binding (GO:0051287)
Molecular Function: 4-hydroxythreonine-4-phosphate dehydrogenase activity (GO:0050570)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 33746.8 Da
SQ 323 aa
 
........10........20........30........40........50
| | | | |
MMVPSLALVPGEPAGIGPELCVRLAQQPRSDAHLIAYADPDTLHSAATAL
SLPVRLLEPNQPARVPGDLPLHPIRQAVATRFGVPDPANAAAVIAGLRSA
AADCLAGRLQGIVTGPVHKAAINAGGIAYTGTTELLAEQAGCPVVMMLAN
SIVRVALVTTHLPLRAVADAITADALRQCLRITHAAMQRDFGLEHPRIAV
LGLNPHAGEDGHLGREELDIVIPALEQLRGQGMQLIGPLPADTAFLPQKL
RGFDAVVAMYHDQGLPVLKYSGFEQAVNITLGLPYPRVAVDHGTALELAG
RGIADPSSLMAATALCARLAARR
Show or not Domain decomposition
 
Hamap PDXA_MF_00536 raw_score=6792 norm_score=34.304

4-hydroxythreonine-4-phosphate dehydrogenase [pdxA].

XFF4834R

NP_641216.1 lcl|pdxA-XAC0864

1

308

S=1542 I=98 E=8.81105e-180

4-hydroxythreonine-4-phosphate dehydrogenase

XFF4834R

YP_362632.1 lcl|pdxA-XCV0901

1

308

S=1513 I=96 E=2.70644e-176

4-hydroxythreonine-4-phosphate dehydrogenase

XFF4834R

NP_636183.1 lcl|pdxA-XCC0792

2

308

S=1391 I=88 E=1.72836e-161

4-hydroxythreonine-4-phosphate dehydrogenase

XFF4834R

lcl|pdxA-XALc_2763

2

308

S=1068 I=75 E=2.45525e-122

probable 4-hydroxythreonine-4-phosphate dehydrogenase protein

pubmed

6

308

S=732 I=52 E=5.48374e-80

4-hydroxythreonine-4-phosphate dehydrogenase EC=1.1.1.262 ; Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthes

Pubmed 2670894,1630901

 

prodomImg

pubmed

4

308

S=659 I=52 E=3.25393e-71

4-hydroxythreonine-4-phosphate dehydrogenase EC=1.1.1.262 ; Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthesis Zin

Pubmed 19077236

 

prodomImg

pubmed

2

305

S=437 I=38 E=2.49227e-44

4-hydroxythreonine-4-phosphate dehydrogenase 2 EC=1.1.1.262 ; Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Plasmid Pyridoxine bio

Pubmed 11481431

 

prodomImg

pubmed

4

308

S=412 I=35 E=2.78439e-41

Phosphate biosynthetic protein PdxA ; Cytoplasm Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthesis

Pubmed 17971441

 

prodomImg

pubmed

4

305

S=410 I=36 E=4.61687e-41

4-hydroxythreonine-4-phosphate dehydrogenase 3 EC=1.1.1.262 ; Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Plasmid Pyridoxine bio

Pubmed 11481431

 

prodomImg

pubmed

4

308

S=404 I=33 E=2.64027e-40

4-hydroxythreonine-4-phosphate dehydrogenase EC=1.1.1.262 ; Cytoplasm Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthesis

Pubmed 10484179

 

prodomImg

pubmed

97

308

S=345 I=39 E=3.38002e-33

Pyridoxal phosphate biosynthetic protein

Pubmed 17894863

 

prodomImg

pubmed

83

308

S=315 I=38 E=1.73658e-29

PdxA homolog ; Plasmid

Pubmed 8828207

 

prodomImg

pubmed

6

308

S=280 I=31 E=2.65327e-25

1,2-dihydroxy-3,5-cyclohexadiene-1,4-dicarboxylate dehydrogenase

Pubmed 16517628

 

prodomImg

pubmed

6

308

S=273 I=31 E=1.93689e-24

1,2-dihydroxy-3,5-cyclohexadiene-1,4-dicarboxylate dehydrogenase

Pubmed 16517628

 

prodomImg

sp_Pdown

sp|Q8PP24|PDXA_XANAC

1

308

S=1542 I=98 E=2.30413e-178

4-hydroxythreonine-4-phosphate dehydrogenase EC=1.1.1.262 ; Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthesis Zin

sp_Pdown

sp|B2SPT4|PDXA_XANOP

2

308

S=1415 I=91 E=6.53481e-163

4-hydroxythreonine-4-phosphate dehydrogenase EC=1.1.1.262 ; Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthesis Zin

sp_Pdown

sp|B0RUI2|PDXA_XANCB

2

308

S=1400 I=89 E=4.18212e-161

4-hydroxythreonine-4-phosphate dehydrogenase EC=1.1.1.262 ; Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthesis Zin

sp_Pdown

sp|Q8PCE2|PDXA_XANCP

2

308

S=1391 I=88 E=4.51972e-160

4-hydroxythreonine-4-phosphate dehydrogenase EC=1.1.1.262 ; Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthesis Zin

sp_Pdown

sp|Q4UR40|PDXA_XANC8

2

308

S=1391 I=88 E=4.51972e-160

4-hydroxythreonine-4-phosphate dehydrogenase EC=1.1.1.262 ; Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthesis Zin

Iprscan IPR005255 [MF_00536]

2

320

Pyridoxal phosphate (active vitamin B6) biosynthesis PdxA

Iprscan IPR005255 [PF04166]

24

317

Pyridoxal phosphate (active vitamin B6) biosynthesis PdxA

Iprscan IPR005255 [TIGR00557]

6

320

Pyridoxal phosphate (active vitamin B6) biosynthesis PdxA

Iprscan [seg]

309

323

-

PD017805

11

308

S=666 I=50 E=3.51522e-73

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gYd0CS8O)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

48 hits
swiss-prot

Swiss-Prot ncbi-blastp

138 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr08680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr08680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr08680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr08680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pdxH XFF4834R_chr16180
XFF4834R_chr16170
XFF4834R_chr16170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16190
XFF4834R_chr16190
ID pdxH
AC XFF4834R_chr16180
LT XFF4834R_chr16180
OR XFF4834R_chr from 1873590 to 1874189 on strand +
DE putative pyridoxine/pyridoxamine 5'-phosphate oxidase
IP Pyridoxamine 5'-phosphate oxidase; Pyridoxine 5'-phosphate oxidase, dimerisation, C-terminal; Pyridoxamine 5'-phosphate oxidase, conserved site
CL 1.5.3.6 Pyridoxine (vitamin B6) GO:0008615
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: pyridoxine biosynthetic process (GO:0008615)
Molecular Function: FMN binding (GO:0010181)
Molecular Function: pyridoxamine-phosphate oxidase activity (GO:0004733)
acting on the CH-NH2 group of donors (GO:0016638)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100408)
MW 22266.8 Da
SQ 199 aa
 
........10........20........30........40........50
| | | | |
MTDLYAEALATFAALYAEAHNSAELEASAMTVATANVDGRPSARTVLLKA
FDARGFVFYTHLDSAKGRDLQTHPQAALLFLWRSLREAGIQVRIEGGVQL
VSADESDAYFASRPRMSQIGAWASRQSQALGSREEFDAAIAKVEATFEGR
EVPRPDGWGGFRVVPQAFEFWYGAKFRLHERWRYEADAASHWSKRMLYP
Show or not Domain decomposition
 
Hamap PDXH_MF_01629 raw_score=5115 norm_score=34.851

Pyridoxine/pyridoxamine 5'-phosphate oxidase [pdxH].

XFF4834R

NP_643318.1 lcl|pdxH-XAC3009

1

199

S=935 I=91 E=1.59401e-106

pyridoxamine 5'-phosphate oxidase

XFF4834R

YP_364890.1 lcl|pdxH-XCV3159

1

199

S=930 I=90 E=7.45939e-106

pyridoxamine 5'-phosphate oxidase

XFF4834R

NP_638188.1 lcl|pdxH-XCC2840

1

199

S=914 I=88 E=5.88495e-104

pyridoxamine 5'-phosphate oxidase

XFF4834R

lcl|XALc_2164

21

199

S=673 I=73 E=9.94889e-75

putative pyridoxamine 5'-phosphate oxidase protein

pubmed

25

199

S=476 I=55 E=2.24067e-49

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

Pubmed 2152896,2152902

 

prodomImg

pubmed

22

199

S=429 I=49 E=1.04418e-43

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

Pubmed 7524725

 

prodomImg

pubmed

26

199

S=397 I=48 E=8.08196e-40

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

Pubmed 15618402

 

prodomImg

pubmed

26

199

S=394 I=43 E=2.3009e-39

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

Pubmed 16707693

 

prodomImg

pubmed

26

199

S=384 I=43 E=3.34468e-38

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

Pubmed 15637156

 

prodomImg

pubmed

26

199

S=381 I=44 E=7.86017e-38

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

Pubmed 17107561

 

prodomImg

pubmed

26

181

S=355 I=45 E=9.49832e-35

Pyridoxine-5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase Phosphoprotein Pyridoxal biosynthesis

Pubmed 9601034

 

prodomImg

pubmed

26

199

S=355 I=43 E=1.03636e-34

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

Pubmed 17592475

 

prodomImg

pubmed

26

181

S=351 I=46 E=3.19132e-34

Pyridoxine 5'-phosphate oxidase

Pubmed 18424774

 

prodomImg

pubmed

26

181

S=351 I=47 E=3.79928e-34

Pyridoxine 5'-phosphate oxidase

Pubmed 16636282

 

prodomImg

sp_Pdown

sp|Q8PI89|PDXH_XANAC

1

199

S=935 I=91 E=3.82445e-105

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

sp_Pdown

sp|Q3BQS3|PDXH_XANC5

1

199

S=930 I=90 E=1.7897e-104

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

sp_Pdown

sp|Q5H3H2|PDXH_XANOR

1

199

S=914 I=88 E=1.24971e-102

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

sp_Pdown

sp|Q2P6C7|PDXH_XANOM

1

199

S=914 I=88 E=1.24971e-102

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

sp_Pdown

sp|Q8P6X5|PDXH_XANCP

1

199

S=914 I=88 E=1.41195e-102

Pyridoxine/pyridoxamine 5'-phosphate oxidase EC=1.4.3.5 ; Flavoprotein FMN Oxidoreductase biosynthesis

Iprscan IPR012349 [G3DSA:2.30.110.10]

2

199

FMN-binding split barrel

Iprscan IPR000659 [MF_01629]

3

199

Pyridoxamine 5'-phosphate oxidase

Iprscan IPR011576 [PF01243]

1

105

Pyridoxamine 5'-phosphate oxidase-like, FMN-binding domain

Iprscan IPR019576 [PF10590]

158

199

Pyridoxine 5'-phosphate oxidase, dimerisation, C-terminal

Iprscan IPR019740 [PS01064]

168

181

Pyridoxamine 5'-phosphate oxidase, conserved site

Iprscan [seg]

4

19

-

PDA0O356

101

199

S=273 I=56 E=1.38379e-25

PD006312

26

99

S=219 I=59 E=5.27249e-19

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FtgBpQRS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

281 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr16180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr16180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr16180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVkz8In/XFF4834R_chr16180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.