Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr03480XFF4834R_chr03620714_0401577_f1_XFF4834R-XFF4834R_chr03480XFF4834R_chr03480Putative CoA-transferase protein conserved
  2. XFF4834R_chr03490XFF4834R_chr03630574_0402362_f3_XFF4834R-XFF4834R_chr03490XFF4834R_chr03490Putative CoA-transferase protein conserved
  3. XFF4834R_chr13950coaEXFF4834R_chr13950probable dephospho-CoA kinase
  4. XFF4834R_chr25370coaDXFF4834R_chr25370pantetheine-phosphate adenylyltransferase
  5. XFF4834R_chr38020dfpXFF4834R_chr38020probable bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase

XFF4834R_chr03620714_0401577_f1_XFF4834R-XFF4834R_chr03480 XFF4834R_chr03480
XFF4834R_chr_0385
XFF4834R_chr_0385
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03490
XFF4834R_chr03490
ID XFF4834R_chr03620714_0401577_f1_XFF4834R-XFF4834R_chr03480
AC XFF4834R_chr03480
LT XFF4834R_chr03480
OR XFF4834R_chr from 400714 to 401577 on strand +
DE Putative CoA-transferase protein conserved
IP Coenzyme A transferase
CL 1.5.3.5 Coenzyme A GO:0015937
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: CoA-transferase activity (GO:0008410)

Curated
PM
AN se nomme gctA chez les autres xantho mais je n ai rien pour le valider ainsi
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100719)
MW 31139.2 Da
SQ 287 aa
 
........10........20........30........40........50
| | | | |
MAEIVALADAVSQLIADGDCVAMEGFTHLIPHAAGHEVIRQRKRALRLVR
MTPDLIYDQLIGAGCATALRFSWGGNPGVGSLHRLRDAVEHAWPQPLQIR
EHSHADMANAYVAGASGLPFAVLRGYVGSDLLRVNDSIRFLQCPYTGQTL
ATSPAVNPDVTVIHAQQADRRGNVLLWGILGVQKEAALAARKVIVTVEEI
VDSLDAPPNACILPRWVVDAVCVVPGGAAPSYAHGYYARDNRFYLAWDAI
ARDRATFQAWIQAHILDTDDFAGFQGVYARSQQQVAA
XFF4834R

NP_640720.1 lcl|gctA-XAC0364

1

287

S=1453 I=97 E=4.15475e-169

glutaconate CoA transferase subunit A

XFF4834R

YP_362109.1 lcl|gctA-XCV0378

1

287

S=1450 I=96 E=1.24636e-168

glutaconate CoA transferase subunit A

XFF4834R

NP_635759.1 lcl|gctA-XCC0364

1

287

S=1398 I=92 E=2.49108e-162

glutaconate CoA transferase subunit A

pubmed

1

282

S=1085 I=70 E=7.5609e-123

3-oxoadipate CoA-transferase subunit A EC=2.8.3.6 ; Aromatic hydrocarbons catabolism

Pubmed 11741863,11741862

 

prodomImg

pubmed

1

266

S=867 I=60 E=1.75391e-96

Putative acetate CoA-transferase, alpha-subunit

Pubmed 15066829

 

prodomImg

pubmed

1

270

S=273 I=30 E=1.91543e-24

Glutaconate CoA-transferase subunit A EC=2.8.3.12 ; Cytoplasm

Pubmed 7957258,9083111

 

prodomImg

pubmed

3

203

S=226 I=33 E=8.32476e-19

Putative acyl-CoA transferase

Pubmed 15599705

 

prodomImg

pubmed

6

251

S=218 I=34 E=9.7312e-18

Putative glutaconate CoA-transferase subunit A

Pubmed 12029052

 

prodomImg

sp_Pdown

sp|Q8VPF3|CATI_PSESB

1

282

S=1085 I=70 E=5.15033e-123

3-oxoadipate CoA-transferase subunit A EC=2.8.3.6 ; Aromatic hydrocarbons catabolism

sp_Pdown

sp|O29069|Y1199_ARCFU

3

283

S=274 I=30 E=8.29143e-25

Uncharacterized protein AF_1199 ; Transferase

sp_Pdown

sp|Q59111|GCTA_ACIFV

1

270

S=273 I=30 E=1.30475e-24

Glutaconate CoA-transferase subunit A EC=2.8.3.12 ; Cytoplasm

sp_Pdown

sp|P71850|Y3551_MYCTU

97

269

S=135 I=27 E=5.86917e-08

Putative CoA-transferase subunit alpha Rv3551/MT3655 EC=2.8.3.-

Iprscan [G3DSA:3.40.1080.10]

2

274

-

Iprscan IPR004165 [PF01144]

6

223

Coenzyme A transferase

Iprscan IPR004165 [SM00882]

5

224

Coenzyme A transferase

PD961642

3

169

S=393 I=49 E=3.99119e-40

PD477798

172

241

S=176 I=56 E=7.38053e-14

PD670537

239

273

S=118 I=69 E=8.21813e-07

Iprscan [SSF100950]

2

276

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one sihxGR2C)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr03480.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr03480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr03480.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr03480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr03630574_0402362_f3_XFF4834R-XFF4834R_chr03490 XFF4834R_chr03490
XFF4834R_chr03480
XFF4834R_chr03480
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03500
XFF4834R_chr03500
ID XFF4834R_chr03630574_0402362_f3_XFF4834R-XFF4834R_chr03490
AC XFF4834R_chr03490
LT XFF4834R_chr03490
OR XFF4834R_chr from 401574 to 402362 on strand +
DE Putative CoA-transferase protein conserved
IP Coenzyme A transferase
CL 1.5.3.5 Coenzyme A GO:0015937
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: CoA-transferase activity (GO:0008410)

Curated
PM
AN s appelle gctB chez xav xac et xcc mais je n ai rien trouve pour le valider
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100719)
MW 27087.3 Da
SQ 262 aa
 
........10........20........30........40........50
| | | | |
MSAYSTNEMMTVAAARRLPDGAVCFVGIGLPSTAANLARLTHAPDVTLIY
ESGPIGARPQVLPLSIGDGELAETADTVVSTPEIFRYWLQGGRVDVGFLG
AAQIDRHANLNTTVIGSYEAPKTRLPGAGGAPEIAASAKQVFIIMRQSTR
SFVSSLDFITTVGHLDGGDARARAGLPGAGPTVVVTNLCVMEPDPVTCEL
TVTSLHPGTTREQVSAATGWPIRFAADLAQTTPPSSAELDALRALQARTD
AAHGAQAAGAQA
XFF4834R

XFF4834R_chr34710 lcl|atoA-XFF4834R_chr34710

6

151

S=133 I=29 E=1.00687e-09

acetyl-CoA:acetoacetyl-CoA transferase, beta subunit

XFF4834R

NP_640721.1 lcl|gctB-XAC0365

1

250

S=1146 I=90 E=6.88859e-132

glutaconate CoA transferase subunit B

XFF4834R

YP_362110.1 lcl|gctB-XCV0379

1

250

S=1134 I=89 E=1.97667e-130

glutaconate CoA transferase subunit B

XFF4834R

NP_635760.1 lcl|gctB-XCC0365

1

249

S=1056 I=83 E=5.34711e-121

glutaconate CoA transferase subunit B

XFF4834R

lcl|lpsJ-XALc_2690

6

151

S=135 I=29 E=2.26093e-09

probable succinyl-coa:3-ketoacid-coenzyme a transferase subunit b protein

XFF4834R

YP_365432.1 lcl|wxcJ-XCV3701

6

151

S=133 I=31 E=3.52694e-09

3-oxoacid CoA transferase beta subunit

XFF4834R

NP_643884.1 lcl|ipsJ-XAC3577

1

151

S=132 I=29 E=5.04249e-09

IpsJ protein

XFF4834R

NP_636020.1 lcl|ipsJ-XCC0628

6

151

S=130 I=29 E=8.50815e-09

IpsJ protein

XFF4834R

lcl|pcaJ-XALc_3032

15

156

S=128 I=31 E=1.67951e-08

probable 3-oxoadipate coa-transferase subunit b protein

pubmed

1

249

S=907 I=69 E=2.2318e-101

3-oxoadipate CoA-transferase subunit B EC=2.8.3.6 ; Aromatic hydrocarbons catabolism

Pubmed 11741863,11741862

 

prodomImg

pubmed

4

249

S=771 I=58 E=7.86471e-85

Putative acetoacetyl-CoA transferase beta-subunit

Pubmed 15066829

 

prodomImg

pubmed

4

222

S=272 I=31 E=2.16708e-24

Glutaconate CoA-transferase subunit B EC=2.8.3.12 ; Cytoplasm

Pubmed 7957258,9083111

 

prodomImg

pubmed

4

245

S=227 I=31 E=6.94151e-19

Putative acyl-CoA transferase

Pubmed 15599705

 

prodomImg

pubmed

1

246

S=199 I=29 E=1.46557e-15

TesB, ORF1, ORF2, ORF3 genes, complete cds

Pubmed 11739769

 

prodomImg

sp_Pdown

sp|Q8VPF2|CATJ_PSESB

1

249

S=907 I=69 E=1.52098e-101

3-oxoadipate CoA-transferase subunit B EC=2.8.3.6 ; Aromatic hydrocarbons catabolism

sp_Pdown

sp|Q59112|GCTB_ACIFV

4

222

S=272 I=31 E=1.47687e-24

Glutaconate CoA-transferase subunit B EC=2.8.3.12 ; Cytoplasm

sp_Pdown

sp|P63653|Y3582_MYCBO

8

245

S=149 I=26 E=1.1034e-09

Putative CoA-transferase subunit beta Mb3582 EC=2.8.3.-

sp_Pdown

sp|P63652|Y3552_MYCTU

8

245

S=149 I=26 E=1.1034e-09

Putative CoA-transferase subunit beta Rv3552/MT3656 EC=2.8.3.-

sp_Pdown

sp|P0C7I8|SCOB_XANCP

6

151

S=130 I=29 E=2.37258e-07

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B EC=2.8.3.5 ; Lipopolysaccharide biosynthesis

Iprscan [G3DSA:3.40.810.20]

2

244

-

Iprscan [PTHR13707:SF1]

14

151

-

Iprscan IPR004165 [PTHR13707]

14

151

Coenzyme A transferase

Iprscan IPR004165 [PF01144]

7

216

Coenzyme A transferase

Iprscan IPR004165 [SM00882]

8

217

Coenzyme A transferase

Iprscan [seg]

165

181

-

Iprscan [seg]

251

262

-

PD488617

27

141

S=159 I=35 E=9.79382e-12

PD713456

90

163

S=156 I=45 E=1.81884e-11

PD004976

8

245

S=148 I=27 E=1.7859e-10

Iprscan [SSF100950]

1

245

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zRXknI0V)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

14 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr03490.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr03490.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr03490.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr03490.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
coaE XFF4834R_chr13950
XFF4834R_chr_1499
XFF4834R_chr_1499
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13960
XFF4834R_chr13960
ID coaE
AC XFF4834R_chr13950
LT XFF4834R_chr13950
OR XFF4834R_chr from 1595930 to 1596538 on strand -
DE probable dephospho-CoA kinase
IP Dephospho-CoA kinase
CL 1.5.3.5 Coenzyme A GO:0015937
EC
GO InterPro
Biological Process: coenzyme A biosynthetic process (GO:0015937)
Molecular Function: dephospho-CoA kinase activity (GO:0004140)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 21572.4 Da
SQ 202 aa
 
........10........20........30........40........50
| | | | |
MSDFIVGLTGGIASGKSALAAEFEKLGVPVIDADVVARQVVAPGPILDAI
AAHFGDSVLLPDGTLNRQALRYRVFADTAQRQALEAITHPAIRRELQRAA
LAAQGPYAIVAIPLLAEAGGRATYPWLDRILVVDVPVALQHERLMQRDGA
TAELADRMIAAQATREQRLAIADDVACNHGVLEQLSQVARGLDVDYRARA
NP
XFF4834R

NP_643552.1 lcl|coaE-XAC3244

1

202

S=893 I=87 E=1.896e-101

dephospho-CoA kinase

XFF4834R

YP_365087.1 lcl|coaE-XCV3356

1

201

S=732 I=75 E=7.20869e-82

dephospho-CoA kinase

XFF4834R

NP_638449.1 lcl|coaE-XCC3102

1

198

S=662 I=74 E=1.95165e-73

dephospho-CoA kinase

XFF4834R

lcl|coaE-XALc_0663

1

198

S=496 I=58 E=2.91677e-53

probable dephospho-coa kinase (dephosphocoenzyme a kinase) protein

pubmed

1

198

S=662 I=74 E=6.86405e-72

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 8817497

 

prodomImg

pubmed

4

190

S=402 I=48 E=2.15144e-40

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 8202364

 

prodomImg

pubmed

1

178

S=383 I=49 E=4.62611e-38

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 10735861

 

prodomImg

pubmed

1

178

S=374 I=49 E=5.36073e-37

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 7905475

 

prodomImg

pubmed

4

178

S=369 I=47 E=2.53059e-36

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 10024587

 

prodomImg

pubmed

4

180

S=325 I=43 E=5.19623e-31

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 8820654

 

prodomImg

pubmed

4

178

S=324 I=42 E=6.69109e-31

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 10419967

 

prodomImg

pubmed

5

196

S=303 I=35 E=1.98648e-28

Predicted dephospho-CoA kinase ; ATP-binding Nucleotide-binding

Pubmed 14566056

 

prodomImg

pubmed

5

201

S=303 I=35 E=2.20558e-28

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Pubmed 10988064

 

prodomImg

pubmed

4

148

S=290 I=42 E=9.45163e-27

Putative dephospho-CoA kinase ; ATP-binding Nucleotide-binding

Pubmed 14742510

 

prodomImg

sp_Pdown

sp|Q8PHK7|COAE_XANAC

1

202

S=893 I=87 E=4.61954e-100

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q5H2I4|COAE_XANOR

1

201

S=795 I=79 E=3.34143e-88

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q2P5F7|COAE_XANOM

1

201

S=795 I=79 E=3.34143e-88

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q3BQ76|COAE_XANC5

1

201

S=732 I=75 E=1.75637e-80

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q56764|COAE_XANCP

1

198

S=662 I=74 E=4.75513e-72

Dephospho-CoA kinase EC=2.7.1.24 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Transferase

Iprscan [G3DSA:3.40.50.300]

4

192

-

Iprscan [PTHR10695]

77

185

-

Iprscan IPR001977 [PF01121]

5

180

Dephospho-CoA kinase

Iprscan IPR001977 [TIGR00152]

5

194

Dephospho-CoA kinase

Iprscan [seg]

91

104

-

PD003329

30

119

S=170 I=42 E=3.95343e-13

PD582583

117

193

S=137 I=43 E=4.08009e-09

PDA4R4F8

105

196

S=128 I=28 E=5.29544e-08

Iprscan [SSF52540]

4

193

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XbbpksfU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

254 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr13950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr13950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr13950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr13950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
coaD XFF4834R_chr25370
XFF4834R_chr25360
XFF4834R_chr25360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25380
XFF4834R_chr25380
ID coaD
AC XFF4834R_chr25370
LT XFF4834R_chr25370
OR XFF4834R_chr from 2928343 to 2928849 on strand -
DE pantetheine-phosphate adenylyltransferase
IP Coenzyme A biosynthesis protein; Rossmann-like alpha/beta/alpha sandwich fold
CL 1.5.3.5 Coenzyme A GO:0015937
EC
GO InterPro
Biological Process: coenzyme A biosynthetic process (GO:0015937)
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: nucleotidyltransferase activity (GO:0016779)
Molecular Function: pantetheine-phosphate adenylyltransferase activity (GO:0004595)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: validated by darrasse (20120403)
MW 18269.7 Da
SQ 168 aa
 
........10........20........30........40........50
| | | | |
MSVANSRTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL
SLERRVALAQEALAAHANVEVRGFDTLLAHFVREMGAGVLLRGLRAVSDF
EYEFQMASMNRHLIPEVETLFLTPAEQYSFISSSLVREIARLGGDVSGFV
PASVVEALRQVRQSRAQA
Show or not Domain decomposition
 
Hamap COAD_MF_00151 raw_score=4112 norm_score=35.549

Phosphopantetheine adenylyltransferase [coaD].

XFF4834R

YP_364440.1 lcl|coaD-XCV2709

1

168

S=799 I=93 E=4.04139e-90

phosphopantetheine adenylyltransferase

XFF4834R

NP_642841.1 lcl|coaD-XAC2526

1

168

S=799 I=93 E=4.07678e-90

phosphopantetheine adenylyltransferase

XFF4834R

NP_637745.1 lcl|coaD-XCC2391

1

167

S=777 I=91 E=1.74558e-87

phosphopantetheine adenylyltransferase

XFF4834R

lcl|coaD-XALc_1943

1

164

S=688 I=83 E=9.81356e-77

putative phosphopantetheine adenylyltransferase (pantetheine-phosphate adenylyltransferase) (ppat) (dephospho-coa pyrophosphorylase) protein

pubmed

1

164

S=688 I=83 E=3.25762e-75

Putative uncharacterized protein kdtB

Pubmed 16102911

 

prodomImg

pubmed

6

158

S=489 I=58 E=4.5254e-51

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 11371519

 

prodomImg

pubmed

7

159

S=484 I=63 E=1.63032e-50

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 8765743

 

prodomImg

pubmed

6

158

S=482 I=56 E=3.21825e-50

Phosphopantetheine adenyltransferase

Pubmed 12427940

 

prodomImg

pubmed

7

158

S=479 I=57 E=8.25207e-50

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 2033061,8041620

 

prodomImg

pubmed

6

158

S=455 I=59 E=5.96175e-47

CoaD

Pubmed 18310345

 

prodomImg

pubmed

6

158

S=454 I=58 E=9.21933e-47

CoaD

Pubmed 19151135

 

prodomImg

pubmed

9

160

S=424 I=50 E=3.77594e-43

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 12427940

 

prodomImg

pubmed

7

163

S=418 I=50 E=1.92798e-42

Predicted phosphopantetheine adenylyltransferase ; Nucleotidyltransferase

Pubmed 10988064

 

prodomImg

pubmed

9

155

S=404 I=51 E=9.01468e-41

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 18441057

 

prodomImg

sp_Pdown

sp|Q3BS23|COAD_XANC5

1

168

S=799 I=93 E=9.34499e-89

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

sp_Pdown

sp|Q8PJK5|COAD_XANAC

1

168

S=799 I=93 E=9.42682e-89

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

sp_Pdown

sp|Q5GZV9|COAD_XANOR

1

168

S=789 I=92 E=1.60317e-87

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

sp_Pdown

sp|B2SIL3|COAD_XANOP

1

168

S=789 I=92 E=1.60317e-87

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

sp_Pdown

sp|Q2P2V0|COAD_XANOM

1

168

S=789 I=92 E=1.60317e-87

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Iprscan IPR001980 [PR01020]

7

25

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

25

46

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

54

78

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

90

106

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

117

139

Coenzyme A biosynthesis protein

Iprscan IPR014729 [G3DSA:3.40.50.620]

7

164

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [PTHR21342]

6

167

-

Iprscan [PTHR21342]

6

167

-

Iprscan IPR004820 [PF01467]

10

139

Cytidylyltransferase

Iprscan IPR004821 [TIGR00125]

8

68

Cytidyltransferase-related

Iprscan IPR001980 [TIGR01510]

8

162

Coenzyme A biosynthesis protein

PDA1F710

68

145

S=307 I=74 E=8.51529e-30

PD004081

9

81

S=144 I=43 E=5.51054e-10

Iprscan [SSF52374]

6

168

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one G88cETDN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

37 hits
swiss-prot

Swiss-Prot ncbi-blastp

574 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr25370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr25370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr25370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr25370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
dfp XFF4834R_chr38020
XFF4834R_chr38010
XFF4834R_chr38010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38030
XFF4834R_chr38030
ID dfp
AC XFF4834R_chr38020
LT XFF4834R_chr38020
OR XFF4834R_chr from 4391267 to 4392541 on strand -
DE probable bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
IP Flavoprotein; DNA/pantothenate metabolism flavoprotein, C-terminal
CL 1.5.3.5 Coenzyme A GO:0015937
EC
GO InterPro
Biological Process: coenzyme A biosynthetic process (GO:0015937)
Biological Process: pantothenate catabolic process (GO:0015941)
Molecular Function: phosphopantothenate--cysteine ligase activity (GO:0004632)
Molecular Function: phosphopantothenoylcysteine decarboxylase activity (GO:0004633)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: FMN binding (GO:0010181)

Curated
PM
AN synonym: coaBC - Coenzyme A biosynthesis bifunctional protein CoaBC
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100409)
MW 44005.7 Da
SQ 424 aa
 
........10........20........30........40........50
| | | | |
MIGSTQARPLDGQRLLLCVGGGIAAYKSLELVRRLRDAGAQVQVAMTGGA
QQFVTPLSFQALSGQPTRTTLWDSAAEQAMGHIELARWADRVIVAPATAD
LLARLAHGLADDLVTTLCLATTAPLTVAPAMNHRMWLHPATQANIATLRA
RGVTVVGPDDGPLAEGESGPGRLAEPAAILAALAGGAAAASTAPEGARSV
AAPVFIPSSAQLEGLRIVISAGPTFEDLDPVRYVGNRSSGKMGYALAAAA
ARQGADVVLVSGPVHQTTPDGVQRIDVRSAAQMRDAVLGAFPADIYIGAA
AVADYTPKRVVSQKIKKTGETLTLELVRTPDILSEVAAQTGALKLVVGFA
AETHDVEHYARGKLAAKRLDLIIANQVGIEGGGFESDNNAATAYWQGGER
VFPSSSKTELADQLLALIAERLQA
Show or not Domain decomposition
 
XFF4834R

NP_644215.1 lcl|dfp-XAC3914

1

424

S=1862 I=87 E=0

bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase

XFF4834R

YP_365758.1 lcl|dfp-XCV4027

1

424

S=1813 I=86 E=0

bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase

XFF4834R

NP_639199.1 lcl|dfp-XCC3859

1

424

S=1790 I=83 E=0

bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase

XFF4834R

lcl|coaBC-XALc_0373

4

424

S=1447 I=68 E=3.61355e-168

probable coenzyme a biosynthesis bifunctional protein coabc (dna/pantothenate metabolism flavoprotein)

pubmed

10

421

S=807 I=47 E=5.35416e-89

Coenzyme A biosynthesis bifunctional protein coaBC EC=4.1.1.36 EC=6.3.2.5 ; Decarboxylase Flavoprotein FMN Ligase Lyase Magnesium Metal-bindin

Pubmed 7686882

 

prodomImg

pubmed

10

419

S=742 I=42 E=4.09444e-81

Coenzyme A biosynthesis bifunctional protein CoaBC; phosphopantothenoylcysteine synthetase/decarboxylase EC=4.1.1.36 EC=6.3.2.5 Putative Dfp pro

Pubmed 9534248

 

prodomImg

pubmed

13

423

S=667 I=37 E=5.70959e-72

Pantothenate metabolism flavoprotein

Pubmed 17636987

 

prodomImg

pubmed

10

423

S=654 I=39 E=1.72635e-70

Putative phosphopantothenoylcysteine synthetase/decarboxylase

Pubmed 17472632

 

prodomImg

pubmed

10

423

S=650 I=38 E=5.95404e-70

Pantothenate metabolism flavoprotein homolog

Pubmed 10746777

 

prodomImg

pubmed

53

392

S=434 I=33 E=8.32969e-44

Undec1A

Pubmed 17420004

 

prodomImg

pubmed

208

422

S=283 I=35 E=1.96224e-25

MTW1216

Pubmed 11544247

 

prodomImg

pubmed

14

107

S=142 I=34 E=2.03847e-08

MTW1216

Pubmed 11544247

 

prodomImg

pubmed

13

171

S=269 I=37 E=8.938e-24

Probable phosphopantothenoylcysteine decarboxylase EC=4.1.1.36 ; Flavoprotein FMN Lyase

Pubmed 8763945

 

prodomImg

pubmed

212

384

S=251 I=41 E=1.34425e-21

Putative pantothenate metabolism flavoprotein

Pubmed 17333169,15101981

 

prodomImg

sp_Pdown

sp|Q87T89|COABC_VIBPA

10

422

S=880 I=46 E=5.07925e-98

Coenzyme A biosynthesis bifunctional protein coaBC EC=4.1.1.36 EC=6.3.2.5 ; Decarboxylase Flavoprotein FMN Ligase Lyase Magnesium Metal-binding Mult

sp_Pdown

sp|Q9KVD1|COABC_VIBCH

10

422

S=873 I=47 E=3.80612e-97

Coenzyme A biosynthesis bifunctional protein coaBC EC=4.1.1.36 EC=6.3.2.5 ; Decarboxylase Flavoprotein FMN Ligase Lyase Magnesium Metal-binding Mult

sp_Pdown

sp|Q5E8M6|COABC_VIBF1

10

422

S=871 I=45 E=7.00709e-97

Coenzyme A biosynthesis bifunctional protein coaBC EC=4.1.1.36 EC=6.3.2.5 ; Decarboxylase Flavoprotein FMN Ligase Lyase Magnesium Metal-binding Mult

sp_Pdown

sp|Q8DDX8|COABC_VIBVU

10

418

S=820 I=46 E=9.13573e-91

Coenzyme A biosynthesis bifunctional protein coaBC EC=4.1.1.36 EC=6.3.2.5 ; Decarboxylase Flavoprotein FMN Ligase Lyase Magnesium Metal-binding Multifunctional

sp_Pdown

sp|Q7MPS9|COABC_VIBVY

10

418

S=820 I=46 E=1.13607e-90

Coenzyme A biosynthesis bifunctional protein coaBC EC=4.1.1.36 EC=6.3.2.5 ; Decarboxylase Flavoprotein FMN Ligase Lyase Magnesium Metal-binding Mult

Iprscan IPR003382 [G3DSA:3.40.50.1950]

5

198

Flavoprotein

Iprscan IPR007085 [G3DSA:3.40.50.10300]

207

423

DNA/pantothenate metabolism flavoprotein, C-terminal

Iprscan IPR003382 [PF02441]

13

130

Flavoprotein

Iprscan IPR007085 [PF04127]

212

400

DNA/pantothenate metabolism flavoprotein, C-terminal

Iprscan IPR005252 [TIGR00521]

10

419

Bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase

Iprscan [seg]

109

130

-

Iprscan [seg]

173

197

-

Iprscan [seg]

245

251

-

PD002847

15

172

S=421 I=52 E=1.76431e-43

PD005411

212

287

S=190 I=56 E=1.72353e-15

PD136292

322

423

S=182 I=48 E=1.40918e-14

PDA1Z8E2

15

69

S=153 I=56 E=4.60091e-11

PD615097

19

106

S=111 I=33 E=6.49367e-06

PDA1F9P2

294

322

S=102 I=69 E=6.6602e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one kDmPLk5a)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

21 hits
swiss-prot

Swiss-Prot ncbi-blastp

20 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr38020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr38020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr38020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBumz1i1/XFF4834R_chr38020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.