Xanthomonas fuscans subsp. fuscans

9 hits

  1. XFF4834R_chr09480moaBXFF4834R_chr09480probable molybdenum cofactor biosynthesis protein B
  2. XFF4834R_chr10780moaAXFF4834R_chr10780probable molybdenum cofactor biosynthesis protein A
  3. XFF4834R_chr10800moaCXFF4834R_chr10800probable molybdenum cofactor biosynthesis protein C
  4. XFF4834R_chr10810moaDXFF4834R_chr10810probable molybdopterin-converting factor chain 1
  5. XFF4834R_chr10820moaEXFF4834R_chr10820probable molybdopterin-converting factor chain 2
  6. XFF4834R_chr21250moeA1XFF4834R_chr21250probable molybdopterin biosynthesis protein
  7. XFF4834R_chr21260moeBXFF4834R_chr21260probable molybdopterin synthase sulfurylase
  8. XFF4834R_chr21350moeA2XFF4834R_chr21350probable molybdopterin biosynthesis protein
  9. XFF4834R_chr21360mobAXFF4834R_chr21360putative molybdopterin-guanine dinucleotide synthase

moaB XFF4834R_chr09480
XFF4834R_chr09470
XFF4834R_chr09470
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09490
XFF4834R_chr09490
ID moaB
AC XFF4834R_chr09480
LT XFF4834R_chr09480
OR XFF4834R_chr from 1088555 to 1089073 on strand -
DE probable molybdenum cofactor biosynthesis protein B
IP Molybdopterin binding;
CL 1.5.3.4 Molybdenum (molybdopterin) GO:0006777
EC
GO InterPro
Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 18726.1 Da
SQ 172 aa
 
........10........20........30........40........50
| | | | |
MPSTLDFISLRLCVLTVSDSRTLAEDRSGDYLADVLTHEGHVLHERALCP
DDRYRMRAIVSGWIADAQVDGILITGGTGFTGRDSTPEAITPLLDKVMPG
FGEMFRAISVEEIGTSSLQSRAFAGLANHSFVFCLPGSTSACRTAWEKIV
RAQLDARTKPCNLATLRPRLGE
XFF4834R

NP_641294.1 lcl|moaB-XAC0942

1

172

S=839 I=94 E=6.09687e-95

molybdopterin biosynthesis protein B

XFF4834R

YP_362704.1 lcl|moaB-XCV0973

1

172

S=822 I=92 E=5.67661e-93

molybdenum cofactor biosynthesis protein B

XFF4834R

NP_636256.1 lcl|moaB-XCC0865

1

172

S=793 I=88 E=2.00468e-89

molybdopterin biosynthesis protein B

XFF4834R

lcl|moaB-XALc_0483

1

172

S=659 I=73 E=3.73815e-73

probable molybdenum cofactor biosynthesis protein b

pubmed

7

172

S=631 I=74 E=2.88677e-68

MoaB

Pubmed 19218412

 

prodomImg

pubmed

4

163

S=428 I=50 E=1.26761e-43

Molybdenum cofactor biosynthesis protein B ; GTP-binding Nucleotide-binding

Pubmed 8361352

 

prodomImg

pubmed

8

165

S=422 I=47 E=6.47237e-43

Molybdopterin cofactor biosynthesis protein

Pubmed 17509837

 

prodomImg

pubmed

6

163

S=418 I=49 E=2.10011e-42

Putative molybdenum cofactor biosynthesis protein B

Pubmed 11133432

 

prodomImg

pubmed

10

154

S=261 I=39 E=1.89446e-23

Molybdenum cofactor biosynthesis protein B

Pubmed 9387221

 

prodomImg

pubmed

10

155

S=241 I=39 E=5.92642e-21

Molybdenum cofactor biosynthesis protein B

Pubmed 9675851,19060169

 

prodomImg

pubmed

9

155

S=238 I=35 E=1.19046e-20

Molybdenum cofactor biosynthesis protein B

Pubmed 15590099

 

prodomImg

pubmed

10

152

S=193 I=36 E=4.05319e-15

Molybdopterin biosynthesis enzyme

Pubmed 18830277

 

prodomImg

pubmed

8

138

S=155 I=30 E=1.48093e-10

Molybdopterin biosynthesis enzymes

Pubmed 16309397

 

prodomImg

pubmed

9

152

S=146 I=28 E=1.62864e-09

Gephyrin ; Alternative splicing Cell junction membrane Cytoplasm Cytoskeleton Disease mutation Magnesium Metal-binding Molybdenum cofactor b

Pubmed 11095995,11418245

 

prodomImg

sp_Pdown

sp|P0AEZ9|MOAB_ECOLI

4

163

S=428 I=50 E=8.81896e-44

Molybdenum cofactor biosynthesis protein B ; GTP-binding Nucleotide-binding

sp_Pdown

sp|P0AF00|MOAB_ECO57

4

163

S=428 I=50 E=8.81896e-44

Molybdenum cofactor biosynthesis protein B

sp_Pdown

sp|O34457|MOAB_BACSU

10

154

S=261 I=39 E=1.318e-23

Molybdenum cofactor biosynthesis protein B

sp_Pdown

sp|Q9K8I4|MOAB_BACHD

9

154

S=254 I=37 E=1.11586e-22

Molybdenum cofactor biosynthesis protein B

sp_Pdown

sp|Q816R0|MOAB_BACCR

10

154

S=250 I=37 E=3.37673e-22

Molybdenum cofactor biosynthesis protein B

Iprscan IPR001453 [G3DSA:3.40.980.10]

6

171

Molybdopterin binding

Iprscan IPR012245 [PIRSF006443]

1

164

Molybdenum cofactor biosynthesis protein MoaB

Iprscan IPR001453 [PF00994]

13

156

Molybdopterin binding

Iprscan IPR001453 [SM00852]

13

157

Molybdopterin binding

Iprscan IPR013484 [TIGR02667]

6

168

Molybdenum cofactor biosynthesis protein B, proteobacteria

Iprscan IPR020817 [TIGR00177]

9

152

Molybdenum cofactor synthesis

Iprscan [seg]

75

82

-

PD405346

10

162

S=327 I=47 E=3.37421e-32

PDA67145

144

172

S=118 I=72 E=7.56525e-07

PDA185N0

144

172

S=107 I=69 E=1.85554e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vTL0Xsvw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr09480.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr09480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr09480.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr09480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
moaA XFF4834R_chr10780
XFF4834R_chr10770
XFF4834R_chr10770
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10790
XFF4834R_chr10790
ID moaA
AC XFF4834R_chr10780
LT XFF4834R_chr10780
OR XFF4834R_chr from 1216014 to 1217045 on strand +
DE probable molybdenum cofactor biosynthesis protein A
IP MoaA/nifB/pqqE, iron-sulphur binding, conserved site; Molybdenum cofactor synthesis C-terminal
CL 1.5.3.4 Molybdenum (molybdopterin) GO:0006777
EC
GO InterPro
4 sulfur cluster binding (GO:0051539)
Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)
Biological Process: metabolic process (GO:0008152)
Cellular Component: molybdopterin synthase complex (GO:0019008)
Molecular Function: iron-sulfur cluster binding (GO:0051536)
Molecular Function: metal ion binding (GO:0046872)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 37551.7 Da
SQ 343 aa
 
........10........20........30........40........50
| | | | |
MGALLQPDLVMAPMQDRYGRPLRDLRLSVIEACNFRCGYCMPADRVPDDY
GFDSQQRLSFDQLETLVRAFVSVGVTKVRLTGGEPLLRRDLPSLIARLTA
IEGIEDLALTTNGTLLARQAVALRQAGLRRITVSMDALEPALFRRMSGDR
GEIAQVLAGIAAAEQAGFQRLKINCVLQRGVNEDQVLPLVEHFRGTGHVL
RFIEFMDVGSCNGWTADAVVTSAQLHERIHARWPLVALDANYTGEVAQRH
AFADGAGEVGFVSSVSVPFCGDCQRARVSADGHLYTCLFASQGHDLKPAL
ANGAPALATHLRQRWSVRGDRYSEVRASVPRRGKPVEMFLIGG
Show or not Domain decomposition
 
Hamap MOAA_MF_01225_B raw_score=7047 norm_score=39.306

Molybdenum cofactor biosynthesis protein A [moaA].

XFF4834R

XFF4834R_chr15150 lcl|XFF4834R_chr16240242_1739360_r2_XFF4834R-XFF4834R_chr15150

27

179

S=109 I=25 E=1.06969e-06

XFF4834R

YP_362836.1 lcl|moaA-XCV1105

1

343

S=1677 I=94 E=0

molybdenum cofactor biosynthesis protein A

XFF4834R

NP_641435.1 lcl|moaA-XAC1097

10

343

S=1638 I=93 E=0

molybdenum cofactor biosynthesis protein A

XFF4834R

NP_636372.1 lcl|moaA-XCC0995

7

343

S=1498 I=85 E=2.09765e-174

molybdenum cofactor biosynthesis protein A

XFF4834R

lcl|moaA-XALc_0606

1

343

S=1163 I=66 E=7.97456e-134

probable molybdenum cofactor biosynthesis protein a

XFF4834R

NP_643426.1 lcl|pqqE-XAC3117

27

179

S=108 I=25 E=5.61387e-06

pyrroloquinoline quinone biosynthesis protein PqqE

XFF4834R

YP_364979.1 lcl|pqqE-XCV3248

27

179

S=100 I=25 E=5.51222e-05

pyrroloquinoline quinone biosynthesis protein PqqE

pubmed

15

343

S=858 I=52 E=2.63865e-95

Molybdenum cofactor biosynthesis protein A ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-adenosyl-L-methionine

Pubmed 19128515

 

prodomImg

pubmed

14

343

S=731 I=47 E=7.41861e-80

Molybdenum cofactor biosynthesis protein A ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-adenosyl-L-methionine

Pubmed 7860592

 

prodomImg

pubmed

10

343

S=705 I=40 E=8.50783e-77

Molybdenum cofactor biosynthesis protein A ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-adenosyl-L-methionine

Pubmed 9675851,19060169

 

prodomImg

pubmed

10

343

S=690 I=39 E=6.71209e-75

Molybdenum cofactor biosynthesis protein A ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-adenosyl-L-methionine

Pubmed 15317939

 

prodomImg

pubmed

14

304

S=487 I=36 E=2.84634e-50

Molybdenum cofactor biosynthesis protein 1 ; 4Fe-4S Alternative splicing GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-ad

Pubmed 10917590

 

prodomImg

pubmed

12

300

S=481 I=35 E=1.47889e-49

Molybdenum cofactor biosynthesis protein 1 ; 4Fe-4S Alternative splicing GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-ad

Pubmed 10917590

 

prodomImg

pubmed

14

304

S=468 I=34 E=5.27719e-48

Molybdenum cofactor biosynthesis protein 1 ; 4Fe-4S Alternative splicing Disease mutation GTP-binding Iron Iron-sulfur Metal-binding Nucleo

Pubmed 9731530

 

prodomImg

pubmed

16

304

S=459 I=34 E=6.38768e-47

Molybdopterin biosynthesis protein CNX2 ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Molybdenum cofactor Nucleotide-binding S-adenosyl-L

Pubmed 7890743

 

prodomImg

pubmed

6

315

S=446 I=35 E=2.08903e-45

Putative MoaA-like protein ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Molybdenum cofactor biosynthesis Nucleotide-binding Plasmid S-adeno

Pubmed 17337569,15533053

 

prodomImg

pubmed

12

312

S=424 I=34 E=1.10266e-42

Molybdenum cofactor biosynthesis protein A ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-adenosyl-L-methionine

Pubmed 8361352

 

prodomImg

sp_Pdown

sp|Q8PNH1|MOAA_XANAC

10

343

S=1638 I=93 E=0

Molybdenum cofactor biosynthesis protein A ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-adenosyl-L-methionine

sp_Pdown

sp|Q8PBX1|MOAA_XANCP

7

343

S=1498 I=85 E=5.47281e-173

Molybdenum cofactor biosynthesis protein A ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-adenosyl-L-methionine

sp_Pdown

sp|Q4URN0|MOAA_XANC8

7

343

S=1498 I=85 E=5.47281e-173

Molybdenum cofactor biosynthesis protein A ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-adenosyl-L-methionine

sp_Pdown

sp|B0RTE0|MOAA_XANCB

7

343

S=1495 I=85 E=1.39112e-172

Molybdenum cofactor biosynthesis protein A ; 4Fe-4S GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-adenosyl-L-methionine

Iprscan IPR013785 [G3DSA:3.20.20.70]

31

169

Aldolase-type TIM barrel

Iprscan IPR007197 [PF04055]

27

193

Radical SAM

Iprscan IPR010505 [PF06463]

198

324

Molybdenum cofactor synthesis C-terminal

Iprscan IPR006638 [SM00729]

23

225

Elongator protein 3/MiaB/NifB

Iprscan IPR013483 [TIGR02666]

14

343

Molybdenum cofactor biosynthesis protein A

Iprscan IPR000385 [PS01305]

29

40

MoaA/nifB/pqqE, iron-sulphur binding, conserved site

Iprscan [seg]

115

130

-

PD000790

20

328

S=494 I=37 E=2.20698e-52

PDA3Y6A5

257

304

S=128 I=46 E=4.9994e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CX58iyWs)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

30 hits
swiss-prot

Swiss-Prot ncbi-blastp

247 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10780.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10780.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
moaC XFF4834R_chr10800
XFF4834R_chr10790
XFF4834R_chr10790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10810
XFF4834R_chr10810
ID moaC
AC XFF4834R_chr10800
LT XFF4834R_chr10800
OR XFF4834R_chr from 1217448 to 1217945 on strand +
DE probable molybdenum cofactor biosynthesis protein C
IP Molybdopterin cofactor biosynthesis MoaC region
CL 1.5.3.4 Molybdenum (molybdopterin) GO:0006777
EC
GO InterPro
Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 17581.2 Da
SQ 165 aa
 
........10........20........30........40........50
| | | | |
MPAKSRSARLTHLDDAGLPTMVDVSDKAVTARSATAESRVRFPAAVAAQL
RANGLRSAKGGIVETAVIAGTMAVKRTHELIPFCHPLPIDACRFEIDWAG
KQLLDIRCTVRCVHRTGVEMEALTGASVAALTVYDMCKALSHSMSIGPTK
LVSKRGGKRDIGAEQ
Show or not Domain decomposition
 
XFF4834R

YP_362838.1 lcl|moaC-XCV1107

1

165

S=842 I=98 E=2.35046e-95

molybdenum cofactor biosynthesis protein C

XFF4834R

NP_641436.1 lcl|moaC-XAC1098

1

165

S=832 I=96 E=3.41672e-94

molybdenum cofactor biosynthesis protein C

XFF4834R

NP_636374.1 lcl|moaC-XCC0997

1

163

S=789 I=93 E=6.6582e-89

molybdenum cofactor biosynthesis protein C

XFF4834R

lcl|moaC-XALc_0608

10

163

S=651 I=79 E=3.35452e-72

probable molybdenum cofactor biosynthesis protein c

pubmed

8

165

S=329 I=47 E=9.79997e-32

Molybdenum cofactor synthesis/low xanthine dehydrogenase

Pubmed 12384303

 

prodomImg

pubmed

10

159

S=328 I=44 E=1.27297e-31

Molybdenum cofactor biosynthesis protein C

Pubmed 9202461

 

prodomImg

pubmed

8

165

S=321 I=47 E=9.21205e-31

Molybdenum cofactor biosynthesis protein 1 ; 4Fe-4S Alternative splicing GTP-binding Iron Iron-sulfur Metal-binding Nucleotide-binding S-ad

Pubmed 10917590

 

prodomImg

pubmed

2

158

S=310 I=48 E=2.36013e-29

Molybdopterin cofactor biosynthesis protein ; Molybdenum

Pubmed 17509837

 

prodomImg

pubmed

8

158

S=301 I=47 E=2.68764e-28

Molybdenum cofactor biosynthesis protein C

Pubmed 8361352

 

prodomImg

pubmed

10

158

S=293 I=48 E=2.73263e-27

Molybdenum cofactor biosynthesis protein C

Pubmed 10511537

 

prodomImg

pubmed

8

158

S=284 I=45 E=2.95323e-26

Molybdenum cofactor biosynthesis protein C

Pubmed 9675851,19060169

 

prodomImg

pubmed

2

158

S=278 I=47 E=1.65968e-25

Molybdenum cofactor biosynthesis protein C

Pubmed 9061023

 

prodomImg

pubmed

21

158

S=278 I=48 E=1.82674e-25

Molybdenum cofactor biosynthesis protein

Pubmed 18830277

 

prodomImg

pubmed

9

141

S=267 I=41 E=3.38966e-24

Probable molybdenum cofactor biosynthesis protein C

Pubmed 18790866

 

prodomImg

sp_Pdown

sp|Q3BWM5|MOAC_XANC5

1

165

S=842 I=98 E=5.39728e-94

Molybdenum cofactor biosynthesis protein C

sp_Pdown

sp|B2SLT7|MOAC_XANOP

1

165

S=834 I=96 E=4.8149e-93

Molybdenum cofactor biosynthesis protein C

sp_Pdown

sp|Q2P6W1|MOAC_XANOM

1

165

S=834 I=96 E=4.8149e-93

Molybdenum cofactor biosynthesis protein C

sp_Pdown

sp|Q8PNH0|MOAC_XANAC

1

165

S=832 I=96 E=7.8457e-93

Molybdenum cofactor biosynthesis protein C

sp_Pdown

sp|Q8PBW9|MOAC_XANCP

1

163

S=789 I=93 E=1.5289e-87

Molybdenum cofactor biosynthesis protein C

Iprscan IPR002820 [G3DSA:3.30.70.640]

7

160

Molybdopterin cofactor biosynthesis C (MoaC) domain

Iprscan [PTHR22960]

9

164

-

Iprscan IPR002820 [PF01967]

21

157

Molybdopterin cofactor biosynthesis C (MoaC) domain

Iprscan IPR002820 [TIGR00581]

10

159

Molybdopterin cofactor biosynthesis C (MoaC) domain

PD003575

25

158

S=290 I=48 E=1.04446e-27

PDA2F2D6

57

115

S=129 I=47 E=3.54554e-08

PDA3L7P9

1

24

S=122 I=100 E=2.63378e-07

PDA2V5L8

1

24

S=118 I=96 E=8.39816e-07

PDA3J3D7

115

161

S=118 I=51 E=8.77237e-07

PDA2V5L9

1

24

S=113 I=92 E=3.60189e-06

Iprscan IPR002820 [SSF55040]

17

163

Molybdopterin cofactor biosynthesis C (MoaC) domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AJcZjqip)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

25 hits
swiss-prot

Swiss-Prot ncbi-blastp

321 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
moaD XFF4834R_chr10810
XFF4834R_chr10800
XFF4834R_chr10800
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10820
XFF4834R_chr10820
ID moaD
AC XFF4834R_chr10810
LT XFF4834R_chr10810
OR XFF4834R_chr from 1217942 to 1218187 on strand +
DE probable molybdopterin-converting factor chain 1
IP ThiamineS; Molybdopterin converting factor, subunit 1; Beta-grasp fold, ferredoxin-type
CL 1.5.3.4 Molybdenum (molybdopterin) GO:0006777
EC
GO InterPro
Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)
Biological Process: sulfur metabolic process (GO:0006790)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 8817.9 Da
SQ 81 aa
 
........10........20........30........40........50
| | | | |
MTVMVTVLYFASLREAAGIADERVQTGAQDLRGLYAELDARHGLRWTPAQ
LRVAVDGAFARWEDALRDGSEVVFIPPVSGG
Show or not Domain decomposition
 
XFF4834R

NP_641437.1 lcl|moaD-XAC1099

1

81

S=395 I=96 E=7.31734e-42

molybdopterin-converting factor chain 1

XFF4834R

YP_362839.1 lcl|moaD-XCV1108

1

81

S=393 I=95 E=1.44444e-41

molybdopterin-converting factor chain 1

XFF4834R

NP_636375.1 lcl|moaD-XCC0998

1

81

S=361 I=85 E=9.89533e-38

molybdopterin-converting factor chain 1

XFF4834R

lcl|moaD-XALc_0609

1

81

S=310 I=78 E=1.66129e-31

probable molybdopterin-converting factor chain 1 protein

pubmed

3

81

S=112 I=36 E=6.88859e-06

Molybdenum cofactor synthesis protein 2A ; Cytoplasm biosynthesis

Pubmed 17932292

 

prodomImg

sp_Pdown

sp|A8JJB2|MOC2A_CHLRE

3

81

S=112 I=36 E=4.30037e-06

Molybdenum cofactor synthesis protein 2A ; Cytoplasm biosynthesis

sp_Pdown

sp|P30748|MOAD_ECOLI

4

81

S=102 I=34 E=7.06275e-05

Molybdopterin-converting factor subunit 1 ; Molybdenum cofactor biosynthesis

Iprscan IPR012675 [G3DSA:3.10.20.30]

4

81

Beta-grasp fold, ferredoxin-type

Iprscan IPR003749 [PF02597]

7

81

ThiamineS

Iprscan IPR010034 [TIGR01682]

5

81

Molybdopterin converting factor, subunit 1

PDA2B6M1

5

81

S=177 I=44 E=5.13566e-14

PD407084

10

79

S=107 I=38 E=1.80608e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one u3MjfYGN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10810.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10810.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
moaE XFF4834R_chr10820
XFF4834R_chr10820
XFF4834R_chr10820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1165
XFF4834R_chr_1165
ID moaE
AC XFF4834R_chr10820
LT XFF4834R_chr10820
OR XFF4834R_chr from 1218190 to 1218630 on strand +
DE probable molybdopterin-converting factor chain 2
IP Molybdopterin biosynthesis MoaE
CL 1.5.3.4 Molybdenum (molybdopterin) GO:0006777
EC
GO InterPro
Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 16175.2 Da
SQ 146 aa
 
........10........20........30........40........50
| | | | |
MNEQVAAIFALSEVPLPIDQLRAGVEHPQAGAFASFEGWVRNHNEGRGVA
GLRYEAYAALAQAEGQRVVDEAMQRFAIVHAHCVHRVGELRIGEMAVWVG
VSAAHRGAAFDACRYIIDEVKAWVPIWKHEHYLEGDAGWLHPESQP
Show or not Domain decomposition
 
XFF4834R

YP_362840.1 lcl|moaE-XCV1109

1

146

S=714 I=94 E=5.9391e-80

molybdopterin-converting factor chain 2

XFF4834R

NP_641438.1 lcl|moaE-XAC1100

1

146

S=712 I=95 E=1.05592e-79

molybdopterin-converting factor chain 2

XFF4834R

NP_636376.1 lcl|moaE-XCC0999

1

145

S=622 I=81 E=7.64409e-69

molybdopterin-converting factor chain 2

XFF4834R

lcl|moaE-XALc_0610

4

143

S=481 I=66 E=9.70441e-52

probable molybdopterin-converting factor chain 2 protein

pubmed

11

140

S=273 I=43 E=4.9418e-25

Molybdopterin-converting factor subunit 2 ; Molybdenum cofactor biosynthesis

Pubmed 9495759

 

prodomImg

pubmed

16

139

S=242 I=38 E=2.89373e-21

Molybdenum cofactor synthesis protein 2B ; Cytoplasm Disease mutation biosynthesis Phosphoprotein Polymorphism

Pubmed 10053003,9889283

 

prodomImg

pubmed

1

139

S=241 I=35 E=3.38544e-21

Molybdenum cofactor synthesis protein 2B ; Alternative splicing Cytoplasm biosynthesis Phosphoprotein

Pubmed 10053003

 

prodomImg

pubmed

25

136

S=241 I=43 E=3.66179e-21

Molybdenum cofactor synthesis protein 2B ; Cytoplasm biosynthesis

Pubmed 10940562

 

prodomImg

pubmed

29

141

S=233 I=42 E=3.21021e-20

Molybdopterin converting factor large subunit

Pubmed 17509837

 

prodomImg

pubmed

26

136

S=224 I=41 E=3.91976e-19

Molybdopterin-converting factor subunit 2 ; Molybdenum cofactor biosynthesis

Pubmed 8361352

 

prodomImg

pubmed

11

140

S=223 I=39 E=6.00895e-19

Putative MoaE-like protein ; Plasmid

Pubmed 17337569,15533053

 

prodomImg

pubmed

26

136

S=213 I=41 E=1.02191e-17

Putative molybdopterin converting factor subunit 2

Pubmed 11133432

 

prodomImg

pubmed

18

135

S=210 I=39 E=2.16298e-17

Molybdopterin converting factor large subunit

Pubmed 17372221

 

prodomImg

pubmed

9

139

S=208 I=35 E=3.98206e-17

Molybdenum cofactor synthesis protein 2B ; Cytoplasm biosynthesis

Pubmed 17018643

 

prodomImg

sp_Pdown

sp|Q55371|Y903_SYNY3

7

141

S=332 I=45 E=2.52524e-32

Uncharacterized protein slr0903

sp_Pdown

sp|Q97CL5|MOAE_THEVO

17

139

S=281 I=43 E=3.75237e-26

Molybdopterin-converting factor subunit 2 ; Molybdenum cofactor biosynthesis

sp_Pdown

sp|Q56210|MOAE_SYNE7

11

140

S=273 I=43 E=3.46629e-25

Molybdopterin-converting factor subunit 2 ; Molybdenum cofactor biosynthesis

sp_Pdown

sp|Q9V2A7|MOAE_PYRAB

18

136

S=259 I=47 E=2.05092e-23

Molybdopterin-converting factor subunit 2 ; Molybdenum cofactor biosynthesis

sp_Pdown

sp|A4FUY7|MOC2B_BOVIN

1

139

S=254 I=36 E=6.59691e-23

Molybdenum cofactor synthesis protein 2B ; Cytoplasm biosynthesis Phosphoprotein

Iprscan IPR003448 [G3DSA:3.90.1170.40]

3

143

Molybdopterin biosynthesis MoaE

Iprscan IPR003448 [PF02391]

8

124

Molybdopterin biosynthesis MoaE

PD004055

27

141

S=256 I=44 E=1.37127e-23

PD925175

85

140

S=147 I=48 E=2.74863e-10

PDA1B2C9

16

88

S=129 I=34 E=3.35336e-08

PD362896

29

123

S=114 I=30 E=2.5549e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 7Rucnn8I)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

21 hits
swiss-prot

Swiss-Prot ncbi-blastp

75 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr10820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
moeA1 XFF4834R_chr21250
XFF4834R_chr21240
XFF4834R_chr21240
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2270
XFF4834R_chr_2270
ID moeA1
AC XFF4834R_chr21250
LT XFF4834R_chr21250
OR XFF4834R_chr from 2465406 to 2466626 on strand +
DE probable molybdopterin biosynthesis protein
IP Molybdopterin binding;
CL 1.5.3.4 Molybdenum (molybdopterin) GO:0006777
EC
GO InterPro
Biological Process: molybdopterin cofactor biosynthetic process (GO:0032324)
Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100408)
MW 43090.9 Da
SQ 406 aa
 
........10........20........30........40........50
| | | | |
MTDYPSRIPYTQALQILHSVAASNRSPDENIATSRADGRISAGDLIAPLA
LPPFANSAMDGFALRHADIAAGDASLQLVGEQFAGERWAGTLAAGQCLRI
TTGAPLPDGADTVIAKEDADERDGMVRFQTTPAPGAAVRLAGSDVRAGDL
VIQAGQVLTPARIGLAAALGVSRLAVAPRPTIAVLATGDELIEPGMPLGP
GQIYNSNRDMLMAQLRALGYAPTAWPTLPDDPQRIRTMLEDAAAAFDVVI
TCGGVSAGEKDYLPRLIGELGRIHFWRVRMRPGMPAVLGQIGRCLVLGLP
GNPVSVLATLIAYGVPLLDGLQGRSEPRPVWHAALANPWEKRHERLEFLR
GRLECGEDGRLTALPHRGDASHLLRGAADSNALIVLPEQARRFEAGEIVR
VIPYAL
XFF4834R

XFF4834R_chr21350 lcl|XFF4834R_chr23250600_2477874_f1_XFF4834R-XFF4834R_chr21350

8

362

S=407 I=38 E=1.15139e-42

XFF4834R

NP_642348.1 lcl|moeA-XAC2022

1

406

S=2033 I=98 E=0

molybdopterin biosynthesis

XFF4834R

YP_363804.1 lcl|moeA1-XCV2073

1

406

S=2027 I=98 E=0

molybdopterin biosynthesis protein MoeA

XFF4834R

NP_637353.1 lcl|moeA-XCC1988

1

406

S=1832 I=87 E=0

molybdopterin biosynthesis

XFF4834R

lcl|moeA-XALc_1584

1

404

S=1262 I=64 E=1.15761e-145

probable molybdopterin biosynthesis protein moea.

XFF4834R

NP_642358.1 lcl|moeA-XAC2032

8

362

S=392 I=37 E=2.47042e-40

molybdopterin biosynthesis

XFF4834R

YP_363814.1 lcl|moeA2-XCV2083

8

362

S=386 I=37 E=1.36435e-39

molybdopterin biosynthesis protein MoeA

XFF4834R

NP_637365.1 lcl|moeA-XCC2000

8

362

S=383 I=36 E=3.32008e-39

molybdopterin biosynthesis

pubmed

26

386

S=617 I=39 E=6.3344e-66

Molybdopterin biosynthesis protein moeA ; Magnesium Metal-binding Molybdenum cofactor

Pubmed 3045084

 

prodomImg

pubmed

38

402

S=530 I=37 E=2.18549e-55

Gephyrin ; Cell junction membrane Cytoplasm Cytoskeleton Magnesium Metal-binding Molybdenum cofactor biosynthesis Multifunctional enzyme Nucl

Pubmed 16452087

 

prodomImg

pubmed

38

402

S=529 I=37 E=2.78979e-55

Gephyrin

Pubmed 10839351

 

prodomImg

pubmed

38

402

S=528 I=37 E=3.46923e-55

Gephyrin ; Alternative splicing Cell junction membrane Cytoplasm Cytoskeleton Magnesium Metal-binding Molybdenum cofactor biosynthesis Multifuncti

Pubmed 1319186,11083919

 

prodomImg

pubmed

38

402

S=528 I=37 E=3.65555e-55

Gephyrin ; Alternative splicing Cell junction membrane Cytoplasm Cytoskeleton Disease mutation Magnesium Metal-binding Molybdenum cofactor b

Pubmed 11095995,11418245

 

prodomImg

pubmed

8

403

S=521 I=29 E=2.10882e-54

Molybdenum cofactor biosynthesis protein

Pubmed 10627036

 

prodomImg

pubmed

36

406

S=519 I=36 E=4.3483e-54

MoeA1

Pubmed 14996791

 

prodomImg

pubmed

27

403

S=511 I=37 E=4.12324e-53

Molybdopterin cofactor biosynthesis protein

Pubmed 17509837

 

prodomImg

pubmed

38

402

S=486 I=36 E=3.83582e-50

Gephyrin ; Cell junction membrane Cytoplasm Cytoskeleton Magnesium Metal-binding Molybdenum cofactor biosynthesis Multifunctional enzyme Nucleotide-bi

Pubmed 10649567

 

prodomImg

pubmed

38

404

S=481 I=34 E=1.46886e-49

MoeA protein

Pubmed 9492313

 

prodomImg

sp_Pdown

sp|Q56066|MOEA_SALTY

29

404

S=628 I=38 E=1.68664e-67

Molybdopterin biosynthesis protein moeA ; Molybdenum cofactor

sp_Pdown

sp|P45210|MOEA_HAEIN

29

404

S=619 I=36 E=2.17005e-66

Molybdopterin biosynthesis protein moeA ; Molybdenum cofactor

sp_Pdown

sp|P12281|MOEA_ECOLI

26

386

S=617 I=39 E=4.35903e-66

Molybdopterin biosynthesis protein moeA ; Magnesium Metal-binding Molybdenum cofactor

Iprscan [G3DSA:2.170.190.11]

52

144

-

Iprscan IPR001453 [G3DSA:3.40.980.10]

152

339

Molybdopterin binding

Iprscan IPR005110 [PF03453]

7

170

MoeA, N-terminal region, domain I/II

Iprscan IPR001453 [PF00994]

183

320

Molybdopterin binding

Iprscan IPR005111 [PF03454]

332

405

MoeA, C-terminal, domain IV

Iprscan IPR001453 [SM00852]

183

320

Molybdopterin binding

Iprscan IPR020817 [TIGR00177]

179

316

Molybdenum cofactor synthesis

PD527525

29

176

S=281 I=43 E=1.24669e-26

PD002460

184

325

S=280 I=49 E=1.87813e-26

PDA1P6D9

29

187

S=150 I=28 E=9.72123e-11

PDA1T9X6

1

28

S=134 I=89 E=8.66505e-09

PD582149

339

405

S=119 I=42 E=6.32021e-07

PDA7Y1B3

325

404

S=116 I=34 E=1.43438e-06

PDA845B9

8

71

S=114 I=45 E=2.44141e-06

PDA6P598

126

187

S=112 I=44 E=3.74264e-06

PDA400F9

228

311

S=111 I=30 E=5.35088e-06

PDA7J0V5

324

344

S=108 I=90 E=1.13257e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Qjk0QNiq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
moeB XFF4834R_chr21260
XFF4834R_chr_2270
XFF4834R_chr_2270
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21270
XFF4834R_chr21270
ID moeB
AC XFF4834R_chr21260
LT XFF4834R_chr21260
OR XFF4834R_chr from 2466974 to 2468206 on strand -
DE probable molybdopterin synthase sulfurylase
IP UBA/THIF-type NAD/FAD binding fold; Rhodanese-like; MoeZ/MoeB; NAD(P)-binding domain
CL 1.5.3.4 Molybdenum (molybdopterin) GO:0006777
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100408)
MW 43534.4 Da
SQ 410 aa
 
........10........20........30........40........50
| | | | |
MTRLSSAARCVRVVGKIAHRSCCVLRDNGRMSNHDISPADARARALQGAL
LVDIRQLHERASGQAEGAMAIAQNSLEMEPAVHLPEQTRAIVLICQSGKR
SAHTAAILRTHGYAHVASVAGGTSAWASAGLPLVRPTLPADEQDFLERYS
RHLRLSQVGLEGQRRLARARVLLIGAGGLGSPAAFYLAAAGVGHLRIADD
DVVDRSNLQRQILHTEDSVGTAKVDSAARRIAALNPRVDIEAVQTRVTAD
NVEALLQDVDVVVDGADNFPARYLLNDACVKLAKPLVYGAVQQFEGQVSV
FDAGRHRGHAPCYRCLFPEPPPPEFAPSCAEAGVLGVLPGVIGLLQATEA
IKLLLGIGAGLTGRLLSFDALAMRFRDIRLPPDPHCPVCAPGAVFRGYAD
YAAFCGSAVG
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ymX3Kygq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

104 hits
swiss-prot

Swiss-Prot ncbi-blastp

128 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21260.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21260.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
moeA2 XFF4834R_chr21350
XFF4834R_chr21340
XFF4834R_chr21340
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21360
XFF4834R_chr21360
ID moeA2
AC XFF4834R_chr21350
LT XFF4834R_chr21350
OR XFF4834R_chr from 2476621 to 2477874 on strand +
DE probable molybdopterin biosynthesis protein
IP Molybdopterin binding; Molybdenum cofactor biosynthesis, conserved site;
CL 1.5.3.4 Molybdenum (molybdopterin) GO:0006777
EC
GO InterPro
Biological Process: molybdopterin cofactor biosynthetic process (GO:0032324)
Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)

Curated
PM
AN paralogue XFF4834R2269(moeA1)
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100408)
MW 43648.4 Da
SQ 417 aa
 
........10........20........30........40........50
| | | | |
MISYAEALALVHAHVATLASEWVASADAEGRVLADALSSQAELPPFDNSA
MDGFALATAGIGALADSEHVVSGTVAAGQDAGAAAIGAAWEIMTGAGVPP
GADAVVPIEQVQILEHDGGRPSRIRLHQPVRAGQHIRRRGEDVRLHDRVI
DAGTVLRGAHLMLLAGLGCAHVQVVRRPRVAVIATGRELIGDPAQPLQPG
QIRDGTSSYLLAQLRAAGADVVWRGQVGDDDAAFDAALAQARHAGADLIL
STGAVSRGRYDFIPDALARHAAEVLFHKVAVRPGKPVLLARFSDGTLYMG
LPGNPMASAAGLRFFVEPALRGLLGMPVERGLRVALEAPMQARPIWRQHL
RARLLCSVAGELSVQILPQQESFRVAPLLQANVWAVLEPQDEGAAASTHA
EVFGLGHLQSAAPAIAP
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one tAsqTyjS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21350.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21350.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbQd6fU/XFF4834R_chr21350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
mobA XFF4834R_chr21360
XFF4834R_chr21350
XFF4834R_chr21350
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21370
XFF4834R_chr21370
ID mobA
AC XFF4834R_chr21360
LT XFF4834R_chr21360
OR XFF4834R_chr from 2477912 to 2478481 on strand +
DE putative molybdopterin-guanine dinucleotide synthase
IP
CL 1.5.3.4 Molybdenum (molybdopterin) GO:0006777
EC
GO InterPro


Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100408)
MW 20322.4 Da
SQ 189 aa
 
........10........20........30........40........50
| | | | |
MTLLRPWTGVVLAGGRSSRMGQDKALLPWHGRPLLERMQALLRRAGAQHV
VVSGNRPEYAGIADLQPDLGPLGGLASVIAVADDATTLVVVPVDMPLLSA
ALLGKLLAPSQHRCVAFEDQMLPMCLRLDASVREALAVLMAGAASSRSLR
ALQHSLQCHRVTVTASERAAFVNCNTPEQWSRLIHENPD
Show or not Domain decomposition
 
Hamap MOBA_MF_00316 raw_score=1335 norm_score=18.840

Molybdopterin-guanine dinucleotide biosynthesis protein A [mobA].

XFF4834R

NP_642359.1 lcl|mobA-XAC2033

1

189

S=623 I=67 E=8.49951e-69

molybdopterin guanine dinucleotide synthase

XFF4834R

YP_363815.1 lcl|XCV2084

1

189

S=609 I=66 E=5.39226e-67

hypothetical protein

XFF4834R

NP_637366.1 lcl|mobA-XCC2001

7

189

S=413 I=51 E=2.39053e-43

molybdopterin guanine dinucleotide synthase

sp_Pdown

sp|Q6HCB8|MOBA_BACHK

4

53

S=114 I=44 E=1.12718e-05

Probable molybdopterin-guanine dinucleotide biosynthesis protein A ; Cytoplasm GTP-binding Molybdenum cofactor Nucleotide-binding

sp_Pdown

sp|Q72YW2|MOBA_BACC1

4

53

S=111 I=42 E=2.58053e-05

Probable molybdopterin-guanine dinucleotide biosynthesis protein A ; Cytoplasm GTP-binding Molybdenum cofactor Nucleotide-binding

Iprscan [G3DSA:3.90.550.10]

1

183

-

Iprscan [MF_00316]

5

183

-

Iprscan [seg]

64

75

-

Iprscan [seg]

78

94

-

Iprscan [seg]

97

108

-

Iprscan [seg]

139

157

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL