Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr06760lipBXFF4834R_chr06760probable lipoyl/octanoyl transferase
  2. XFF4834R_chr06770lipAXFF4834R_chr06770probable lipoyl synthase

lipB XFF4834R_chr06760
XFF4834R_chr06750
XFF4834R_chr06750
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06770
XFF4834R_chr06770
ID lipB
AC XFF4834R_chr06760
LT XFF4834R_chr06760
OR XFF4834R_chr from 774837 to 775535 on strand +
DE probable lipoyl/octanoyl transferase
IP Lipoate-protein ligase B
CL 1.5.3.3 Lipoate GO:0009107
EC
GO InterPro
Biological Process: lipoate biosynthetic process (GO:0009107)
Biological Process: protein modification process (GO:0006464)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: octanoyltransferase activity (GO:0016415)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 25159.7 Da
SQ 232 aa
 
........10........20........30........40........50
| | | | |
VDAVAAEPVSSSMAGLPAQLRDLGQQDYAPVWRAMQRFTDAREEYTVDEI
WVVEHAPVFTLGQAGKPEHVLAPGEIPVLQVDRGGQVTYHGPGQLVVYPL
LDLRRLKIGVRDYVCKIEQALIDTLDEWNIVAERRDGAPGVYVGGAKIAA
LGIRVRRGCTFHGLSFNVAMDLQPFHRINPCGYQGLQVTSVLDLGGPSGM
DAVKAVLLDQLARQFGLVLQPTSALPDLSLPA
Show or not Domain decomposition
 
pubmed

20

211

S=620 I=59 E=1.03432e-66

Strongly similar to lipoyltransferase ; Acyltransferase Cytoplasm

Pubmed 16563686

 

prodomImg

pubmed

20

211

S=586 I=56 E=1.32743e-62

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

Pubmed 8444795

 

prodomImg

pubmed

42

224

S=321 I=36 E=2.03378e-30

Plastidial lipoyltransferase 2 EC=2.3.1.- ; Acyltransferase Chloroplast

Pubmed 11602263

 

prodomImg

pubmed

37

220

S=308 I=36 E=6.82757e-29

Lipoyl-[acyl-carrier-protein]-protein-N-lipoyltransferase ; Acyltransferase Cytoplasm

Pubmed 18048332

 

prodomImg

pubmed

19

195

S=307 I=37 E=8.71542e-29

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

Pubmed 17592475

 

prodomImg

pubmed

27

215

S=299 I=33 E=7.8431e-28

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

Pubmed 17483455

 

prodomImg

pubmed

12

215

S=297 I=37 E=1.58926e-27

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

Pubmed 15618402

 

prodomImg

pubmed

27

215

S=295 I=33 E=2.61231e-27

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

Pubmed 18508905

 

prodomImg

pubmed

35

215

S=295 I=36 E=2.77671e-27

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

Pubmed 15637156

 

prodomImg

pubmed

19

215

S=293 I=35 E=5.15671e-27

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

Pubmed 17107561

 

prodomImg

sp_Pdown

sp|Q8PPL9|LIPB_XANAC

1

232

S=1199 I=99 E=5.98647e-137

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

sp_Pdown

sp|Q3BXQ4|LIPB_XANC5

1

232

S=1169 I=96 E=2.13262e-133

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

sp_Pdown

sp|Q8P589|LIPB_XANCP

1

232

S=1123 I=93 E=9.26869e-128

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

sp_Pdown

sp|Q4UYT3|LIPB_XANC8

1

232

S=1123 I=93 E=9.26869e-128

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

sp_Pdown

sp|B0RNP8|LIPB_XANCB

1

232

S=1116 I=92 E=5.39377e-127

Octanoyltransferase EC=2.3.1.181 ; Acyltransferase Cytoplasm

Iprscan [PTHR10993]

26

230

-

Iprscan IPR004143 [PF03099]

71

171

Biotin/lipoate A/B protein ligase

Iprscan IPR000544 [TIGR00214]

38

216

Octanoyltransferase

PD006665

141

223

S=242 I=58 E=6.70396e-22

PDA1S7L2

1

45

S=187 I=80 E=3.34702e-15

PD006086

87

140

S=175 I=64 E=1.07569e-13

PDA1F7O1

42

86

S=158 I=67 E=1.03709e-11

PDA2Q2B8

50

143

S=138 I=33 E=2.97343e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zKFYJJY5)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

25 hits
swiss-prot

Swiss-Prot ncbi-blastp

413 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0nDc6U/XFF4834R_chr06760.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0nDc6U/XFF4834R_chr06760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0nDc6U/XFF4834R_chr06760.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0nDc6U/XFF4834R_chr06760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
lipA XFF4834R_chr06770
XFF4834R_chr06760
XFF4834R_chr06760
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06780
XFF4834R_chr06780
ID lipA
AC XFF4834R_chr06770
LT XFF4834R_chr06770
OR XFF4834R_chr from 775551 to 776564 on strand +
DE probable lipoyl synthase
IP Elongator protein 3/MiaB/NifB
CL 1.5.3.3 Lipoate GO:0009107
EC
GO InterPro
4 sulfur cluster binding (GO:0051539)
Biological Process: lipoate biosynthetic process (GO:0009107)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: lipoate synthase activity (GO:0016992)
Molecular Function: iron-sulfur cluster binding (GO:0051536)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 36820.6 Da
SQ 337 aa
 
........10........20........30........40........50
| | | | |
MTQPIARSIPLQVVSGDTAAPAPLQTGVKQIGGDKINRSPVQFVDAPVLR
KPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATF
MILGEVCTRRCSFCDVAHGRPKPPDANEPASLAATVADMGLKYVVVTSVD
RDDLRDGGAQHFVDCISAIRASSPNTRIEILTPDFRGKGRMDRALEILAS
SPPDVFNHNIETVPDLYPNVRPGADYQWSLTLLQRFKAQHPSIATKSGIM
LGLGETMDQVQATLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEEYK
ALEDYGNALGFSHVASGPMVRSSYHADRQAAGAGVAA
Show or not Domain decomposition
 
pubmed

19

329

S=1069 I=62 E=6.51455e-121

Strongly similar to lipoyl synthase ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 16563686

 

prodomImg

pubmed

19

329

S=1056 I=61 E=2.58101e-119

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 1577793,8444795

 

prodomImg

pubmed

32

328

S=952 I=60 E=1.22746e-106

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 19077236

 

prodomImg

pubmed

24

329

S=910 I=57 E=1.49377e-101

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 8110297

 

prodomImg

pubmed

45

326

S=834 I=57 E=2.45832e-92

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 18700039

 

prodomImg

pubmed

46

327

S=819 I=55 E=1.54607e-90

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 17916642

 

prodomImg

pubmed

50

328

S=800 I=54 E=2.96818e-88

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 9274032

 

prodomImg

pubmed

54

329

S=792 I=53 E=2.40576e-87

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 17038625

 

prodomImg

pubmed

101

329

S=789 I=62 E=5.55592e-87

Putative lipoyl synthase ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 18328084

 

prodomImg

pubmed

45

326

S=781 I=55 E=5.45532e-86

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Pubmed 9141657

 

prodomImg

sp_Pdown

sp|Q3BXQ3|LIPA_XANC5

1

329

S=1757 I=99 E=0

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

sp_Pdown

sp|Q8PPL8|LIPA_XANAC

1

329

S=1752 I=99 E=0

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

sp_Pdown

sp|B0RNP9|LIPA_XANCB

1

329

S=1735 I=97 E=0

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

sp_Pdown

sp|Q5GVR7|LIPA_XANOR

1

329

S=1734 I=98 E=0

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

sp_Pdown

sp|Q2NYZ2|LIPA_XANOM

1

329

S=1734 I=98 E=0

Lipoyl synthase EC=2.8.1.8 ; 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding S-adenosyl-L-methionine Transferase

Iprscan IPR013785 [G3DSA:3.20.20.70]

60

297

Aldolase-type TIM barrel

Iprscan IPR003698 [PIRSF005963]

1

337

Lipoate synthase

Iprscan [PTHR10949]

47

331

-

Iprscan IPR007197 [PF04055]

103

267

Radical SAM

Iprscan IPR006638 [SM00729]

97

305

Elongator protein 3/MiaB/NifB

Iprscan IPR003698 [TIGR00510]

38

337

Lipoate synthase

Iprscan [seg]

330

337

-

PD005028

128

201

S=234 I=62 E=7.06021e-21

PD123922

68

124

S=223 I=72 E=1.25419e-19

PDA1F6Y8

243

297

S=196 I=65 E=2.55723e-16

PD186201

203

245

S=144 I=66 E=5.62556e-10

PDA1U7V6

1

27

S=132 I=100 E=1.49242e-08

Iprscan [SSF102114]

60

327

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gm7FfFHh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

32 hits
swiss-prot

Swiss-Prot ncbi-blastp

476 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0nDc6U/XFF4834R_chr06770.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0nDc6U/XFF4834R_chr06770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0nDc6U/XFF4834R_chr06770.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0nDc6U/XFF4834R_chr06770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.