Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr18820gorXFF4834R_chr18820Probable glutathione reductase

gor XFF4834R_chr18820
XFF4834R_chr18810
XFF4834R_chr18810
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18830
XFF4834R_chr18830
ID gor
AC XFF4834R_chr18820
LT XFF4834R_chr18820
OR XFF4834R_chr from 2153862 to 2155232 on strand +
DE Probable glutathione reductase
IP Mercuric reductase
CL 1.5.3.22 Glutathione redox reactions
EC
GO InterPro
Biological Process: cell redox homeostasis (GO:0045454)
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100827)
MW 49035.6 Da
SQ 456 aa
 
........10........20........30........40........50
| | | | |
MSARYDYDVVILGGGSGGLAAGFRAAKHGARVAIMEPDELGGTCVNLGCV
PKKAMWLAADLAGKIELASALGFDVPRPTLAWQELVTHRQGYIANIHASY
RRRLNEDGVVLIPQRGVLQDRHTVMGSDGVPVTAGHIMIATGAHALRPDV
EGAEHGEVSDDFFNLCHAPEQVAIIGGGYIAVEIAGLLQALGSRVHLFVQ
GERLLERFDAELTLQLADNLRHLGVRLHFGFTTTALERDMHGALRVHGHS
VHPREQGNDIFDKVFFAVGRRANTAGLGLDTVGVALGDKGEVVVDDGQTT
NVPNIHAIGDVGGKVGLTPVAIAAGRKLMDRLFGHQPDARMDYENVPSVV
FSHPPLGNVGLTEEQARARYNGAVRVYRSNFRPMLHALADAPQRSLFKLV
CVGEEERVVGVHLLGESADEMLQGFAVAVKMGATKRDFDETVAIHPTSSE
EIVLMH
XFF4834R

XFF4834R_chr35550 lpd-XFF4834R_chr35550

40

452

S=346 I=27 E=2.78979e-35

lipoamide dehydrogenase, E3 component is part of three enzyme complexes

XFF4834R

XFF4834R_chr29820 XFF4834R_chr_3425781_3427223_f3_XFF4834R-XFF4834R_chr29820

1

452

S=198 I=22 E=2.2293e-17

XFF4834R

XFF4834R_chr09120 ahpF-XFF4834R_chr09120

127

325

S=98 I=29 E=3.78948e-05

alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding

XFF4834R

NP_643059.1 XAC2750-XAC2750

1

456

S=2168 I=92 E=0

reductase

XFF4834R

YP_364634.1 XCV2903

1

456

S=2139 I=91 E=0

putative glutathione reductase

XFF4834R

NP_637927.1 XCC2579

1

456

S=1930 I=82 E=0

reductase

XFF4834R

YP_365508.1 lpdA-XCV3777

40

452

S=351 I=27 E=2.84156e-35

dihydrolipoamide dehydrogenase

XFF4834R

NP_635936.1 lpdA-XCC0544

40

452

S=349 I=27 E=5.417e-35

dihydrolipoamide dehydrogenase

XFF4834R

NP_643966.1 lpdA-XAC3659

40

452

S=348 I=27 E=6.67782e-35

dihydrolipoamide dehydrogenase

XFF4834R

XALc_2914 lpdA-XALc_2914

40

452

S=320 I=26 E=1.45993e-31

probable dihydrolipoamide dehydrogenase (e3 component of 2-oxoglutarate dehydrogenase complex) protein

XFF4834R

NP_639231.1 XCC3891

7

450

S=274 I=26 E=5.96943e-26

mercuric reductase

XFF4834R

YP_363307.1 lpd-XCV1576

1

452

S=209 I=22 E=4.68593e-18

dihydrolipoamide dehydrogenase

XFF4834R

NP_636857.1 ldp-XCC1485

40

452

S=201 I=23 E=4.07239e-17

dihydrolipoamide dehydrogenase

XFF4834R

NP_641866.1 ldp-XAC1533

40

452

S=193 I=23 E=3.478e-16

dihydrolipoamide dehydrogenase

XFF4834R

XALc_1670 lpd-XALc_1670

40

369

S=192 I=23 E=4.84414e-16

probable dihydrolipoamide dehydrogenase protein

XFF4834R

YP_364034.1 XCV2303

1

369

S=118 I=24 E=4.89244e-07

dihydrolipoamide dehydrogenase

XFF4834R

NP_641258.1 ahpF-XAC0906

127

325

S=99 I=30 E=9.89707e-05

alkyl hydroperoxide reductase subunit F

pubmed

6

455

S=922 I=44 E=7.7699e-103

Glutathione reductase EC=1.8.1.7 ; Cytoplasm Disulfide bond FAD Flavoprotein NADP Oxidoreductase Redox-active center

Pubmed 8525054

 

prodomImg

pubmed

28

455

S=882 I=43 E=5.65312e-98

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 11160120

 

prodomImg

pubmed

29

456

S=877 I=45 E=2.40352e-97

Glutathione amide reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 17977556

 

prodomImg

pubmed

28

455

S=865 I=43 E=5.54612e-96

Glutathione reductase EC=1.8.1.7 ; Cytoplasm Disulfide bond FAD Flavoprotein NADP Oxidoreductase Redox-active center

Pubmed 3521741,8041620

 

prodomImg

pubmed

28

455

S=852 I=42 E=2.61592e-94

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 14563169

 

prodomImg

sp_Pdown

acc=Q60151

6

455

S=922 I=44 E=5.28354e-103

Glutathione reductase EC=1.8.1.7 ; Cytoplasm Disulfide bond FAD Flavoprotein NADP Oxidoreductase Redox-active center

sp_Pdown

acc=P06715

28

455

S=865 I=43 E=3.77137e-96

Glutathione reductase EC=1.8.1.7 ; Cytoplasm Disulfide bond FAD Flavoprotein NADP Oxidoreductase Redox-active center

sp_Pdown

acc=A2TIL1

6

453

S=820 I=39 E=1.08803e-90

Glutathione reductase, mitochondrial EC=1.8.1.7 ; Acetylation Alternative initiation Cytoplasm Disulfide bond FAD Flavoprotein Mitochondrion NADP Oxidoreductase P

sp_Pdown

acc=P43783

28

455

S=818 I=43 E=1.96844e-90

Glutathione reductase EC=1.8.1.7 ; Cytoplasm Disulfide bond FAD Flavoprotein NADP Oxidoreductase Redox-active center

sp_Pdown

acc=P47791

29

455

S=812 I=41 E=1.01388e-89

Glutathione reductase, mitochondrial EC=1.8.1.7 ; Acetylation Alternative initiation Cytoplasm Disulfide bond FAD Flavoprotein Mitochondrion NADP

Iprscan [PR00411]

8

30

-

Iprscan [PR00411]

40

55

-

Iprscan [PR00411]

137

146

-

Iprscan [PR00411]

171

196

-

Iprscan [PR00411]

262

276

-

Iprscan [PR00411]

305

312

-

Iprscan [PR00411]

342

363

-

Iprscan [PR00411]

408

423

-

Iprscan [PR00411]

430

450

-

Iprscan IPR013027 [PR00368]

8

30

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

137

146

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

171

196

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

262

276

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

305

312

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR000815 [PR00945]

18

36

Mercuric reductase

Iprscan IPR000815 [PR00945]

171

188

Mercuric reductase

Iprscan IPR000815 [PR00945]

191

206

Mercuric reductase

Iprscan [G3DSA:3.50.50.60]

4

344

-

Iprscan IPR004099 [G3DSA:3.30.390.30]

345

455

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan [PTHR22912:SF27]

10

456

-

Iprscan [PTHR22912]

10

456

-

Iprscan IPR013027 [PF07992]

8

311

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR004099 [PF02852]

346

455

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan IPR001327 [PF00070]

172

242

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR012999 [PS00076]

41

51

Pyridine nucleotide-disulphide oxidoreductase, class I, active site

Iprscan [seg]

13

26

-

Iprscan [seg]

399

416

-

PD704029

191

266

S=374 I=96 E=7.82049e-38

PDA1R5N8

79

114

S=188 I=94 E=3.4398e-15

PD924059

115

158

S=185 I=84 E=7.40877e-15

PD425120

333

384

S=144 I=50 E=7.12503e-10

PD138978

156

212

S=132 I=44 E=2.11708e-08

PDA8N513

262

381

S=120 I=34 E=4.92794e-07

PD985867

429

455

S=115 I=74 E=2.38794e-06

PD327876

265

326

S=105 I=46 E=3.95619e-05

Iprscan [SSF51905]

6

306

-

Iprscan IPR016156 [SSF55424]

343

456

FAD/NAD-linked reductase, dimerisation

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one T7yiC9SK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

253 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

29 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBl4GPpD/XFF4834R_chr18820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBl4GPpD/XFF4834R_chr18820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBl4GPpD/XFF4834R_chr18820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBl4GPpD/XFF4834R_chr18820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.