Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr35090ptpSXFF4834R_chr35090probable6-pyruvoyl tetrahydrobiopterin synthase (PTPS)

ptpS XFF4834R_chr35090
XFF4834R_chr35080
XFF4834R_chr35080
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35100
XFF4834R_chr35100
ID ptpS
AC XFF4834R_chr35090
LT XFF4834R_chr35090
OR XFF4834R_chr from 4075378 to 4075740 on strand +
DE probable6-pyruvoyl tetrahydrobiopterin synthase (PTPS)
IP 6-pyruvoyl tetrahydropterin synthase-related
CL 1.5.3.20 Tetrahydrobiopterin biosynthesis GO:0006729
EC
GO InterPro
Biological Process: tetrahydrobiopterin biosynthetic process (GO:0006729)
Molecular Function: metal ion binding (GO:0046872)
Molecular Function: 6-pyruvoyltetrahydropterin synthase activity (GO:0003874)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100409)
MW 13717.6 Da
SQ 120 aa
 
........10........20........30........40........50
| | | | |
MSRMDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEPGAETG
WIMDFGDIKAAFQPIYDRLDHHYLNEIEGLENPTSERLAIWIWQQLKPAL
PQLSEIVVHETCTSGCRYRG
Show or not Domain decomposition
 
XFF4834R

NP_643921.1 lcl|ptps-XAC3614

1

120

S=641 I=99 E=3.16335e-71

6-pyruvoyl tetrahydrobiopterin synthase

XFF4834R

YP_365465.1 lcl|ptpS-XCV3734

4

120

S=628 I=99 E=1.11899e-69

6-pyruvoyl tetrahydrobiopterin synthase

XFF4834R

NP_635981.1 lcl|ptps-XCC0589

4

120

S=628 I=99 E=1.11899e-69

6-pyruvoyl tetrahydrobiopterin synthase

XFF4834R

lcl|ptpS-XALc_2721

4

120

S=568 I=87 E=1.8286e-62

probable 6-pyruvoyltetrahydropterin synthase protein

pubmed

6

120

S=210 I=38 E=1.35479e-17

ToyB

Pubmed 18721750

 

prodomImg

pubmed

6

119

S=196 I=36 E=6.6169e-16

6-pyruvoyltetrahydropterin synthase EC=4.2.3.12 ExsC protein ; Lyase Plasmid

Pubmed 8544814,11902715

 

prodomImg

pubmed

30

101

S=147 I=40 E=6.41385e-10

Putative uncharacterized protein ORF11

Pubmed 10514376,10430560

 

prodomImg

pubmed

26

120

S=140 I=35 E=3.70004e-09

6-pyruvoyl tetrahydrobiopterin synthase EC=4.2.3.12 ; Lyase Metal-binding Phosphoprotein biosynthesis Zinc

Pubmed 8846895

 

prodomImg

pubmed

31

120

S=123 I=32 E=4.32154e-07

6-pyruvoyl tetrahydrobiopterin synthase EC=4.2.3.12 ; Disease mutation Lyase Metal-binding Phenylketonuria Phosphoprotein biosynthesis Zinc

Pubmed 1282802,8216273

 

prodomImg

pubmed

31

120

S=119 I=31 E=1.33075e-06

6-pyruvoyl tetrahydrobiopterin synthase EC=4.2.3.12 ; Lyase Metal-binding Phenylketonuria Phosphoprotein biosynthesis Zinc

Pubmed 1939130

 

prodomImg

pubmed

31

120

S=118 I=32 E=1.80561e-06

6-pyruvoyl tetrahydrobiopterin synthase EC=4.2.3.12 ; Lyase Metal-binding Phosphoprotein biosynthesis Zinc

Pubmed 9894812

 

prodomImg

sp_Pdown

sp|P65872|PTPS_SHIFL

1

120

S=443 I=66 E=5.89848e-46

Putative 6-pyruvoyl tetrahydrobiopterin synthase EC=4.2.3.12 ; Lyase Metal-binding biosynthesis Zinc

sp_Pdown

sp|P65870|PTPS_ECOLI

1

120

S=443 I=66 E=5.89848e-46

Putative 6-pyruvoyl tetrahydrobiopterin synthase EC=4.2.3.12 ; Lyase Metal-binding biosynthesis Zinc

sp_Pdown

sp|P65871|PTPS_ECO57

1

120

S=443 I=66 E=5.89848e-46

Putative 6-pyruvoyl tetrahydrobiopterin synthase EC=4.2.3.12 ; Lyase Metal-binding biosynthesis Zinc

sp_Pdown

sp|Q8K9D8|PTPS_BUCAP

6

120

S=395 I=63 E=3.30107e-40

Putative 6-pyruvoyl tetrahydrobiopterin synthase EC=4.2.3.12 ; Lyase Metal-binding biosynthesis Zinc

sp_Pdown

sp|Q55798|PTPS_SYNY3

6

118

S=261 I=50 E=5.44824e-24

Putative 6-pyruvoyl tetrahydrobiopterin synthase EC=4.2.3.12 ; Lyase Metal-binding biosynthesis Zinc

Iprscan [G3DSA:3.30.479.10]

6

120

-

Iprscan IPR007115 [PF01242]

3

120

6-pyruvoyl tetrahydropterin synthase-related

Iprscan [TIGR03367]

5

98

-

PD004049

11

120

S=250 I=46 E=8.68942e-23

PD695551

11

120

S=219 I=45 E=4.02094e-19

PD931965

26

89

S=169 I=55 E=4.59977e-13

PD754053

90

120

S=143 I=77 E=6.50291e-10

PDA1U4R0

4

25

S=117 I=100 E=1.06623e-06

PD928475

4

25

S=104 I=86 E=4.33626e-05

PDA2R338

30

101

S=103 I=32 E=5.20753e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JbbAj2XW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

15 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwvWezO/XFF4834R_chr35090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwvWezO/XFF4834R_chr35090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwvWezO/XFF4834R_chr35090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwvWezO/XFF4834R_chr35090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.