Xanthomonas fuscans subsp. fuscans

7 hits

  1. XFF4834R_chr06950folK1XFF4834R_chr06950probable 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase
  2. XFF4834R_chr10330folCXFF4834R_chr10330probable bifunctional protein FolC (folylpolyglutamate synthase/ dihydrofolate synthase)
  3. XFF4834R_chr19140folK2XFF4834R_chr19140probable 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  4. XFF4834R_chr22920folDXFF4834R_chr22920probable bifunctional methylenetetrahydrofolate dehydrogenase /methenyltetrahydrofolate cyclohydrolase
  5. XFF4834R_chr27780folPXFF4834R_chr27780probable dihydropteroate synthase
  6. XFF4834R_chr37590folBXFF4834R_chr37590probable dihydroneopterin aldolase
  7. XFF4834R_chr41720folEXFF4834R_chr41720probable GTP cyclohydrolase I

folK1 XFF4834R_chr06950
XFF4834R_chr06940
XFF4834R_chr06940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06960
XFF4834R_chr06960
ID folK1
AC XFF4834R_chr06950
LT XFF4834R_chr06950
OR XFF4834R_chr from 796447 to 796962 on strand +
DE probable 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase
IP 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
CL 1.5.3.2 Folic acid GO:0046656
EC
GO InterPro
Biological Process: folic acid and derivative biosynthetic process (GO:0009396)
Molecular Function: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity (GO:0003848)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130521)
MW 18697 Da
SQ 171 aa
 
........10........20........30........40........50
| | | | |
MTTVLLSLGSNVQPTHYLRLAVAALRARFGQIVVSPAYRTPAVGFDGPDF
VNNAVVLQTDLDLDPLDHWLHALEDAHGRDRSGPRFSDRTLDLDVVFFGD
RIVEGPGHLRIPRPELKHAFVLKPLADIAPDFIDPLSGQTLATLWQAHPQ
YGSAFATVELDAAAPELSVTQ
XFF4834R

XFF4834R_chr19140 lcl|folK-XFF4834R_chr19140

1

138

S=149 I=35 E=7.05985e-12

2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase

XFF4834R

XFF4834R_chr19140 lcl|folK-XFF4834R_chr19140

1

138

S=149 I=35 E=7.05985e-12

2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase

XFF4834R

NP_641039.1 lcl|folK-XAC0686

1

171

S=726 I=84 E=2.56079e-81

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine

XFF4834R

YP_362478.1 lcl|folK-XCV0747

1

171

S=720 I=83 E=1.35393e-80

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase

XFF4834R

NP_638779.1 lcl|folK-XCC3433

1

163

S=625 I=76 E=5.31954e-69

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine

XFF4834R

lcl|folK-XALc_0832

1

164

S=524 I=62 E=9.44535e-57

probable2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase protein

XFF4834R

NP_637133.1 lcl|XCC1767

1

138

S=180 I=35 E=3.65092e-15

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase

XFF4834R

NP_642111.1 lcl|folK-XAC1784

1

138

S=156 I=35 E=2.92854e-12

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine

XFF4834R

YP_363546.1 lcl|folK-XCV1815

1

138

S=148 I=35 E=2.65851e-11

7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase

XFF4834R

lcl|folK-XALc_1204

32

129

S=144 I=37 E=1.02694e-10

probable 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, hppk; protein

pubmed

32

141

S=165 I=37 E=8.82848e-12

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Pubmed 1325970,8202364

 

prodomImg

pubmed

1

142

S=140 I=33 E=1.01247e-08

Putative 2-amino-4-hydroxy-hydroxymethyldihydopteridine pyrophosphokinase

Pubmed 16817932

 

prodomImg

pubmed

1

135

S=138 I=31 E=1.78445e-08

Dihydropteridine pyrophosphokinase EC=2.7.6.3 Hydroxymethylpterin pyrophosphokinase EC=2.7.6.3 ; Transferase

Pubmed 9593127

 

prodomImg

pubmed

1

135

S=138 I=31 E=1.78445e-08

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Pubmed 9593127

 

prodomImg

pubmed

34

133

S=136 I=38 E=2.98475e-08

7, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

Pubmed 16332180

 

prodomImg

pubmed

46

146

S=136 I=33 E=3.14505e-08

Folic acid synthesis protein fol1 EC=4.1.2.25 EC=2.7.6.3 EC=2.5.1.15 ; ATP-binding Folate biosynthesis Kinase Lyase Multifunctional enzyme Nucle

Pubmed 1313386,8397083

 

prodomImg

pubmed

1

137

S=131 I=29 E=1.31406e-07

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Pubmed 10080886

 

prodomImg

pubmed

34

133

S=128 I=37 E=2.70953e-07

7, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

Pubmed 16332180

 

prodomImg

pubmed

34

133

S=127 I=37 E=3.45873e-07

7, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

Pubmed 16332180

 

prodomImg

pubmed

34

133

S=127 I=37 E=3.45873e-07

7, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

Pubmed 16332180

 

prodomImg

sp_Pdown

sp|P72736|HPPK_SYNY3

34

144

S=194 I=40 E=1.91489e-15

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|P26281|HPPK_ECOLI

32

141

S=165 I=37 E=6.14394e-12

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q9HV71|HPPK_PSEAE

32

152

S=147 I=37 E=8.39529e-10

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q8P151|HPPK_STRP8

1

135

S=141 I=31 E=4.71806e-09

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|P0C0G2|HPPK_STRPY

1

135

S=138 I=31 E=1.24184e-08

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Iprscan IPR000550 [G3DSA:3.30.70.560]

2

155

7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

Iprscan [PTHR20941:SF2]

38

142

-

Iprscan [PTHR20941]

38

142

-

Iprscan IPR000550 [PF01288]

6

128

7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

Iprscan IPR000550 [TIGR01498]

4

130

7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

Iprscan [seg]

18

28

-

Iprscan [seg]

60

73

-

PD003866

32

149

S=201 I=40 E=7.04428e-17

PDA2T6H5

1

159

S=194 I=34 E=4.47276e-16

PD610050

145

171

S=138 I=100 E=2.68176e-09

PDA4T7J7

1

96

S=109 I=31 E=1.00666e-05

Iprscan IPR000550 [SSF55083]

2

155

7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 78tazEWI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

12 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr06950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr06950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr06950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr06950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
folC XFF4834R_chr10330
XFF4834R_chr10320
XFF4834R_chr10320
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10340
XFF4834R_chr10340
ID folC
AC XFF4834R_chr10330
LT XFF4834R_chr10330
OR XFF4834R_chr from 1172545 to 1173843 on strand +
DE probable bifunctional protein FolC (folylpolyglutamate synthase/ dihydrofolate synthase)
IP Folylpolyglutamate synthetase; Mur ligase, C-terminal; Mur ligase, central
CL 1.5.3.2 Folic acid GO:0046656
EC
GO InterPro
Biological Process: folic acid and derivative biosynthetic process (GO:0009396)
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: ligase activity (GO:0016874)
Molecular Function: tetrahydrofolylpolyglutamate synthase activity (GO:0004326)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 45161.5 Da
SQ 432 aa
 
........10........20........30........40........50
| | | | |
MNATDSLSAWLAYIEQQHPSAITMGLERVRAVAARLQTAAPAKHVIVVGG
TNGKGSTVAFIEAIGRAAGWKVGAYTSPHLLRYNERVRIDGNEASDAQLV
DAFAAVEAARGDTALTYFEFGTLAALWLFQQSALDLAVLEIGLGGRLDAV
NIVDSDVAVITTVDLDHTDWLGDDREAIGTEKAGIIRAWKPVVLGEIDPP
SSVLRRAYQLGANAIRAGSDYFFEPIDTQHAEAPQSDAPHWRWRDVAVTL
ELPMPALHAPVQLANAAAAIAALQALPVEVPDAAWAQGIANAQVAGRLQR
LEVDGVQVLLDVGHNPQAARALAAALGTQAHAGSTHAIYAALADKDVLGV
VEAVAGQIDHWALAGLEGARGQSAQALQARLQGSAAAQAPCHRDVAGAVR
AVLGAASPGDRVLIFGSFHTVADALGALRSAR
Show or not Domain decomposition
 
XFF4834R

NP_641376.1 lcl|folC-XAC1029

1

432

S=1845 I=85 E=0

dihydrofolate synthase

XFF4834R

YP_362789.1 lcl|folC-XCV1058

1

432

S=1819 I=84 E=0

folylpolyglutamate synthase/dihydrofolate synthase bifunctional protein

XFF4834R

NP_636336.1 lcl|folC-XCC0950

1

430

S=1508 I=73 E=1.78798e-175

folylpolyglutamate synthase/dihydrofolate synthase

XFF4834R

lcl|folC-XALc_0564

1

431

S=1163 I=59 E=1.05026e-133

probable folc bifunctional protein [includes folylpolyglutamate synthase and dihydrofolate synthase]

pubmed

6

425

S=819 I=45 E=1.91323e-90

Folylpolyglutamate synthetase

Pubmed 11145267

 

prodomImg

pubmed

2

432

S=751 I=41 E=3.20669e-82

Bifunctional protein folC EC=6.3.2.17 EC=6.3.2.12 ; ATP-binding Disulfide bond Folate biosynthesis Ligase Multifunctional enzyme Nucleotide-bindi

Pubmed 3040739,3040734

 

prodomImg

pubmed

6

428

S=675 I=38 E=4.879e-73

FolC protein

Pubmed 8730876,8602142

 

prodomImg

pubmed

5

222

S=378 I=41 E=4.85998e-37

Dihidrofolate synthase

Pubmed 12730156

 

prodomImg

pubmed

11

197

S=331 I=38 E=3.01986e-31

Folylpolyglutamate synthase Bifunctional folylpolyglutamate

Pubmed 18004300

 

prodomImg

pubmed

6

198

S=319 I=40 E=7.21564e-30

FolC protein ; ATP-binding Ligase Nucleotide-binding

Pubmed 12788700

 

prodomImg

pubmed

1

199

S=315 I=40 E=2.09039e-29

Folylpolyglutamate synthase EC=6.3.2.17 ; ATP-binding Ligase Nucleotide-binding One-carbon metabolism

Pubmed 2105929,9618466

 

prodomImg

pubmed

18

195

S=311 I=39 E=7.53086e-29

FolC EC=6.3.2.1 EC=6.3.2.12 ; Ligase

Pubmed 15547262

 

prodomImg

pubmed

1

221

S=310 I=38 E=1.06734e-28

FolC protein ; ATP-binding Ligase Nucleotide-binding

Pubmed 10200311

 

prodomImg

pubmed

26

195

S=310 I=40 E=1.06734e-28

Dihydrofolate synthetase

Pubmed 11752472

 

prodomImg

sp_Pdown

sp|P08192|FOLC_ECOLI

2

432

S=751 I=41 E=2.2079e-82

Bifunctional protein folC EC=6.3.2.17 EC=6.3.2.12 ; ATP-binding Disulfide bond Folate biosynthesis Ligase Multifunctional enzyme Nucleotide-bindi

sp_Pdown

sp|P43775|FOLC_HAEIN

1

423

S=714 I=38 E=6.37503e-78

Folylpolyglutamate synthase EC=6.3.2.17 ; ATP-binding Ligase Nucleotide-binding One-carbon metabolism

sp_Pdown

sp|Q8K9X3|FOLC_BUCAP

6

426

S=584 I=32 E=4.3998e-62

Bifunctional protein folC EC=6.3.2.17 EC=6.3.2.12 ; ATP-binding Folate biosynthesis Ligase Multifunctional enzyme Nucleotide-binding One-carbon metaboli

sp_Pdown

sp|P57265|FOLC_BUCAI

1

426

S=536 I=32 E=2.52759e-56

Bifunctional protein folC EC=6.3.2.17 EC=6.3.2.12 ; ATP-binding Folate biosynthesis Ligase Multifunctional enzyme Nucleotide-binding One-carbon metaboli

sp_Pdown

sp|Q89AT2|FOLC_BUCBP

6

424

S=533 I=30 E=5.39676e-56

Bifunctional protein folC EC=6.3.2.17 EC=6.3.2.12 ; ATP-binding Folate biosynthesis Ligase Multifunctional enzyme Nucleotide-binding One-carbon metaboli

Iprscan IPR013221 [G3DSA:3.40.1190.10]

6

295

Mur ligase, central

Iprscan IPR004101 [G3DSA:3.90.190.20]

296

428

Mur ligase, C-terminal

Iprscan IPR001645 [PTHR11136]

30

358

Folylpolyglutamate synthetase

Iprscan IPR013221 [PF08245]

48

272

Mur ligase, central

Iprscan IPR004101 [PF02875]

294

346

Mur ligase, C-terminal

Iprscan IPR001645 [TIGR01499]

26

428

Folylpolyglutamate synthetase

Iprscan [seg]

256

276

-

Iprscan [seg]

317

333

-

Iprscan [seg]

395

406

-

PD003937

11

255

S=461 I=44 E=2.54744e-48

PD472986

194

255

S=237 I=74 E=3.37939e-21

PDA368U2

277

316

S=194 I=95 E=5.34208e-16

Iprscan IPR013221 [SSF53623]

5

293

Mur ligase, central

Iprscan IPR004101 [SSF53244]

296

430

Mur ligase, C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YMLGzQdI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

30 hits
swiss-prot

Swiss-Prot ncbi-blastp

19 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr10330.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr10330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr10330.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr10330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
folK2 XFF4834R_chr19140
XFF4834R_chr19130
XFF4834R_chr19130
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19150
XFF4834R_chr19150
ID folK2
AC XFF4834R_chr19140
LT XFF4834R_chr19140
OR XFF4834R_chr from 2189863 to 2190348 on strand +
DE probable 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
IP 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
CL 1.5.3.2 Folic acid GO:0046656
EC
GO InterPro
Biological Process: folic acid and derivative biosynthetic process (GO:0009396)
Molecular Function: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity (GO:0003848)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130521)
MW 17310.7 Da
SQ 161 aa
 
........10........20........30........40........50
| | | | |
MQTAFVGLGANLGQAEASVRAAIAALGAVPQTTLIAASRLYRTPAWGRED
QPDFINAVAQLRTELAPLPLLEALLGIEQAFGRERRAGERWGPRTLDLDL
LLYADQVIDLPQLQVPHPHLHARAFALLPLSELAPEAIIPGHGTVRRALH
AIDTCGLEPIG
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr06950 lcl|XFF4834R_chr07270447_0796962_f1_XFF4834R-XFF4834R_chr06950

1

120

S=162 I=38 E=1.34381e-13

XFF4834R

NP_642111.1 lcl|folK-XAC1784

1

161

S=620 I=83 E=1.78399e-68

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine

XFF4834R

YP_363546.1 lcl|folK-XCV1815

1

161

S=619 I=83 E=2.50648e-68

7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase

XFF4834R

NP_637133.1 lcl|XCC1767

1

161

S=573 I=70 E=8.91418e-63

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase

XFF4834R

lcl|folK-XALc_1204

26

161

S=347 I=53 E=1.9608e-35

probable 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, hppk; protein

XFF4834R

NP_641039.1 lcl|folK-XAC0686

1

120

S=165 I=38 E=2.25223e-13

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine

XFF4834R

YP_362478.1 lcl|folK-XCV0747

1

120

S=163 I=38 E=4.60368e-13

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase

XFF4834R

NP_638779.1 lcl|folK-XCC3433

1

122

S=144 I=37 E=7.424e-11

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine

XFF4834R

lcl|folK-XALc_0832

1

120

S=122 I=34 E=3.4084e-08

probable2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase protein

pubmed

1

157

S=271 I=35 E=1.14777e-24

Dihydropteridine pyrophosphokinase EC=2.7.6.3 Hydroxymethylpterin pyrophosphokinase EC=2.7.6.3 ; Transferase

Pubmed 9593127

 

prodomImg

pubmed

1

157

S=271 I=35 E=1.14777e-24

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Pubmed 9593127

 

prodomImg

pubmed

1

151

S=263 I=36 E=1.09789e-23

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Pubmed 1325970,8202364

 

prodomImg

pubmed

1

123

S=233 I=38 E=4.90625e-20

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Pubmed 10080886

 

prodomImg

pubmed

3

123

S=228 I=36 E=2.06787e-19

7, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

Pubmed 16332180

 

prodomImg

pubmed

2

123

S=226 I=35 E=3.51966e-19

7, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

Pubmed 16332180

 

prodomImg

pubmed

2

123

S=226 I=35 E=3.51966e-19

7, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

Pubmed 16332180

 

prodomImg

pubmed

2

123

S=222 I=34 E=1.02859e-18

7, 8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

Pubmed 16332180

 

prodomImg

pubmed

1

158

S=217 I=35 E=3.70558e-18

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Pubmed 9168622

 

prodomImg

pubmed

4

123

S=217 I=38 E=3.73803e-18

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Pubmed 7584024

 

prodomImg

sp_Pdown

sp|Q5XCA6|HPPK_STRP6

1

153

S=274 I=36 E=3.527e-25

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q8K7K6|HPPK_STRP3

1

157

S=273 I=35 E=5.04257e-25

2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase EC=2.7.6.3 ; ATP-binding Folate biosynthesis Nucleotide-binding Transferase

Iprscan IPR000550 [G3DSA:3.30.70.560]

2

160

7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

Iprscan IPR000550 [PF01288]

5

134

7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

Iprscan IPR000550 [TIGR01498]

4

135

7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

Iprscan IPR000550 [PS00794]

90

101

7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

Iprscan [seg]

64

75

-

Iprscan [seg]

124

137

-

PD003866

7

123

S=305 I=50 E=1.64727e-29

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fJnsD8eV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

23 hits
swiss-prot

Swiss-Prot ncbi-blastp

28 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr19140.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr19140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr19140.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr19140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
folD XFF4834R_chr22920
XFF4834R_chr22910
XFF4834R_chr22910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr22930
XFF4834R_chr22930
ID folD
AC XFF4834R_chr22920
LT XFF4834R_chr22920
OR XFF4834R_chr from 2655846 to 2656757 on strand -
DE probable bifunctional methylenetetrahydrofolate dehydrogenase /methenyltetrahydrofolate cyclohydrolase
IP Tetrahydrofolate dehydrogenase/cyclohydrolase; NAD(P)-binding domain; ;
CL 1.5.3.2 Folic acid GO:0046656
EC
GO InterPro
Biological Process: folic acid and derivative biosynthetic process (GO:0009396)
Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100409)
MW 31713.1 Da
SQ 303 aa
 
........10........20........30........40........50
| | | | |
MTASAPAASASARLLDGRRIAEELLDGLKLRVDARVAAGKARPGLAVVLV
GGDPASSVYVRNKRRAAEKVGIEAFDYDLPQGTSEAQLASLIDELNADPK
IHGILIQLPLPGIPDANRLIQRIDPRKDVDGFHPQNVGHLALREFGLRPC
TPRGIVTLLGHTDQPVRGRNATIVGVSNHVGRPMGLELLIAGCTVTSCHK
FTPPDVLEASVRNADILVVAVGRPGLIPGEWVKPGAVVIDVGINRLDDGR
LVGDVGFDAAAQRAAWITPVPGGVGPMTVATLMQNTIEAADAAGIQDSGS
GIR
Hamap FOLD_MF_01576 raw_score=6629 norm_score=36.685

Bifunctional protein folD [folD].

XFF4834R

NP_642606.1 lcl|folD-XAC2289

1

303

S=1487 I=96 E=4.04137e-173

bifunctional methylenetetrahydrofolate dehydrogenase/ methenyltetrahydrofolate cyclohydrolase

XFF4834R

YP_364218.1 lcl|folD-XCV2487

1

302

S=1456 I=95 E=2.28536e-169

bifunctional methylenetetrahydrofolatedehydrogenase/ methenyltetrahydrofolate cyclohydrolase

XFF4834R

NP_637541.1 lcl|folD-XCC2185

16

294

S=1385 I=96 E=7.69421e-161

bifunctional methylenetetrahydrofolate dehydrogenase/ methenyltetrahydrofolate cyclohydrolase

XFF4834R

lcl|folD-XALc_1581

1

293

S=1305 I=87 E=4.40542e-151

probable bifunctional methylenetetrahydrofolatedehydrogenase/methenyltetrahydrofolate cyclohydrolase protein

pubmed

13

291

S=848 I=59 E=4.2498e-94

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon metaboli

Pubmed 8765228

 

prodomImg

pubmed

13

290

S=846 I=59 E=7.17065e-94

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon

Pubmed 8050713

 

prodomImg

pubmed

13

290

S=844 I=59 E=1.27488e-93

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon

Pubmed 1748668

 

prodomImg

pubmed

13

291

S=751 I=57 E=2.0405e-82

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon metabol

Pubmed 19077236

 

prodomImg

pubmed

14

289

S=693 I=54 E=2.45754e-75

Putative 5,10-methylene tetrahydrofolate dehydrogenase

Pubmed 18997407

 

prodomImg

pubmed

13

290

S=659 I=52 E=3.29451e-71

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon metabol

Pubmed 14702322

 

prodomImg

pubmed

13

291

S=647 I=49 E=9.53635e-70

5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase

Pubmed 16796688

 

prodomImg

pubmed

15

289

S=642 I=52 E=3.94987e-69

Putative 5,10-methylene tetrahydrofolate dehydrogenase

Pubmed 18997407

 

prodomImg

pubmed

34

290

S=638 I=51 E=1.10507e-68

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon

Pubmed 15168170

 

prodomImg

pubmed

13

292

S=637 I=51 E=1.30417e-68

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon metabol

Pubmed 17965706

 

prodomImg

sp_Pdown

sp|Q8PK86|FOLD_XANAC

1

303

S=1487 I=96 E=1.04989e-171

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon metabol

sp_Pdown

sp|Q3BSP5|FOLD_XANC5

1

302

S=1456 I=95 E=5.93705e-168

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon metabol

sp_Pdown

sp|Q5H0S4|FOLD_XANOR

13

303

S=1432 I=97 E=4.21511e-165

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon metabol

sp_Pdown

sp|B2SLG3|FOLD_XANOP

13

303

S=1432 I=97 E=4.21511e-165

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon metabol

sp_Pdown

sp|Q2P3R1|FOLD_XANOM

13

303

S=1432 I=97 E=4.21511e-165

Bifunctional protein folD EC=1.5.1.5 EC=3.5.4.9 ; Amino-acid biosynthesis Histidine Hydrolase Methionine Multifunctional enzyme NADP One-carbon metabolism Oxidore

Iprscan [G3DSA:3.40.192.10]

38

124

-

Iprscan IPR016040 [G3DSA:3.40.50.720]

142

275

NAD(P)-binding domain

Iprscan IPR000672 [MF_01576]

12

294

Tetrahydrofolate dehydrogenase/cyclohydrolase

Iprscan IPR020630 [PF00763]

13

130

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

Iprscan IPR020631 [PF02882]

133

294

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

Iprscan [PS00767]

271

279

-

Iprscan [seg]

3

12

-

PD002300

43

151

S=288 I=61 E=2.04276e-27

PD638816

234

287

S=186 I=65 E=4.83632e-15

PD744767

13

147

S=162 I=30 E=3.17449e-12

PDA0Y603

22

142

S=160 I=34 E=7.20453e-12

PDA5G8O2

43

147

S=126 I=33 E=9.08638e-08

PD316754

149

191

S=103 I=49 E=4.96631e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hqD7vY2c)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

75 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr22920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr22920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr22920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr22920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
folP XFF4834R_chr27780
XFF4834R_chr27770
XFF4834R_chr27770
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27790
XFF4834R_chr27790
ID folP
AC XFF4834R_chr27780
LT XFF4834R_chr27780
OR XFF4834R_chr from 3207453 to 3208355 on strand -
DE probable dihydropteroate synthase
IP Dihydropteroate synthase, DHPS; Dihydropteroate synthase
CL 1.5.3.2 Folic acid GO:0046656
EC
GO InterPro
Biological Process: folic acid and derivative biosynthetic process (GO:0009396)
Molecular Function: dihydropteroate synthase activity (GO:0004156)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100409)
MW 31674 Da
SQ 300 aa
 
........10........20........30........40........50
| | | | |
MFDTALTLDCAGRSLRLDAPQVMGIVNVTPDSFSDGGQHATCAAAIAHGL
ALVEQGAAVLDIGGESTRPGAAAVSVEEELQRVIPVIEALAQRTSVPISV
DTFKPEVMRAAVAAGAGLINDVYALRSPGALEAASDLRVPVVLMHARSAP
HAMQDAPHYDDVVGEVHRFLAERIFAAEMAGVDKRRLVLDPGFGFDKTTT
HNLTLLAQLQRLQEFGLPVLAGLSRKRSIGELTGREIAADRVHGSVAAHL
IAAQHGALLLRVHDVAATVDALKVWKAMAAIPVPRVSAPAAPTMRWPDED
Show or not Domain decomposition
 
XFF4834R

NP_642064.1 lcl|folP-XAC1733

1

300

S=1518 I=98 E=6.92665e-177

dihydropteroate synthase

XFF4834R

YP_363497.1 lcl|folP-XCV1766

1

300

S=1415 I=95 E=1.75838e-164

dihydropteroate synthase

XFF4834R

NP_637084.1 lcl|folP-XCC1714

1

300

S=1211 I=84 E=1.10391e-139

dihydropteroate synthase

XFF4834R

lcl|folP-XALc_1165

1

300

S=1125 I=74 E=2.61793e-129

probable dihydropteroate synthase, dhps protein

pubmed

6

277

S=752 I=54 E=1.73391e-82

Dihydropteroate synthase

Pubmed 12441233

 

prodomImg

pubmed

6

277

S=752 I=54 E=1.73391e-82

Dihydropteroate synthase EC=2.5.1.15 ; Antibiotic resistance Folate biosynthesis Transferase

Pubmed 8304179,1522070

 

prodomImg

pubmed

6

277

S=658 I=49 E=4.10853e-71

Dihydropteroate synthase

Pubmed 12019111

 

prodomImg

pubmed

6

277

S=655 I=49 E=9.16316e-71

Dihydropteroate synthase

Pubmed 12019111

 

prodomImg

pubmed

12

277

S=653 I=51 E=1.42941e-70

Dihydropteroate synthase

Pubmed 12019111

 

prodomImg

pubmed

6

277

S=653 I=49 E=1.82465e-70

Dihydropteroate synthase

Pubmed 12019111

 

prodomImg

pubmed

6

277

S=646 I=50 E=1.07112e-69

Dihydropteroate synthase

Pubmed 12019111

 

prodomImg

pubmed

6

277

S=646 I=50 E=1.1485e-69

Dihydropteroate synthase

Pubmed 12019111

 

prodomImg

pubmed

6

277

S=633 I=49 E=4.47161e-68

Dihydropteroate synthase

Pubmed 12019111

 

prodomImg

pubmed

11

279

S=619 I=53 E=2.38292e-66

Dihydropteroate synthase

Pubmed 15673729

 

prodomImg

sp_Pdown

sp|P0AC15|DHPS_SHIFL

6

277

S=752 I=54 E=1.19467e-82

Dihydropteroate synthase EC=2.5.1.15 ; Antibiotic resistance Folate biosynthesis Transferase

sp_Pdown

sp|P0AC13|DHPS_ECOLI

6

277

S=752 I=54 E=1.19467e-82

Dihydropteroate synthase EC=2.5.1.15 ; Antibiotic resistance Folate biosynthesis Transferase

sp_Pdown

sp|P0AC14|DHPS_ECOL6

6

277

S=752 I=54 E=1.19467e-82

Dihydropteroate synthase EC=2.5.1.15 ; Antibiotic resistance Folate biosynthesis Transferase

sp_Pdown

sp|P43776|DHPS_HAEIN

6

279

S=658 I=49 E=2.88061e-71

Dihydropteroate synthase EC=2.5.1.15 ; Antibiotic resistance Folate biosynthesis Transferase

sp_Pdown

sp|Q51161|DHPS_NEIMB

11

279

S=588 I=51 E=8.28965e-63

Dihydropteroate synthase EC=2.5.1.15 ; Antibiotic resistance Folate biosynthesis Transferase

Iprscan IPR000489 [G3DSA:3.20.20.20]

15

288

Dihydropteroate synthase, DHPS

Iprscan IPR000489 [PF00809]

25

233

Dihydropteroate synthase, DHPS

Iprscan IPR006390 [TIGR01496]

21

278

Dihydropteroate synthase

Iprscan IPR000489 [PS00792]

22

37

Dihydropteroate synthase, DHPS

Iprscan IPR000489 [PS00793]

56

69

Dihydropteroate synthase, DHPS

Iprscan IPR000489 [PS50972]

20

273

Dihydropteroate synthase, DHPS

PD001976

11

285

S=499 I=50 E=5.37377e-53

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ToJ1cmPb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

253 hits
swiss-prot

Swiss-Prot ncbi-blastp

47 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr27780.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr27780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr27780.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr27780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
folB XFF4834R_chr37590
XFF4834R_chr37580
XFF4834R_chr37580
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37600
XFF4834R_chr37600
ID folB
AC XFF4834R_chr37590
LT XFF4834R_chr37590
OR XFF4834R_chr from 4346102 to 4346458 on strand -
DE probable dihydroneopterin aldolase
IP Dihydroneopterin aldolase family; Dihydroneopterin aldolase
CL 1.5.3.2 Folic acid GO:0046656
EC
GO InterPro
Biological Process: folic acid and derivative metabolic process (GO:0006760)
Molecular Function: dihydroneopterin aldolase activity (GO:0004150)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100409)
MW 13294.1 Da
SQ 118 aa
 
........10........20........30........40........50
| | | | |
MDKVFIEGLDIDALIGIYDWERRIRQTLRFDLEMGFDNRIPAASDDIADT
LNYKAVSKRLIEFVQASDFGLVETLAERCAALVLDEFGVHWLRLKLSKPG
AVRGAQAVGVIIERERAA
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one d4j0f5tN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

22 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr37590.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr37590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr37590.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr37590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
folE XFF4834R_chr41720
XFF4834R_chr41710
XFF4834R_chr41710
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr41730
XFF4834R_chr41730
ID folE
AC XFF4834R_chr41720
LT XFF4834R_chr41720
OR XFF4834R_chr from 4854589 to 4855191 on strand -
DE probable GTP cyclohydrolase I
IP GTP cyclohydrolase I; GTP cyclohydrolase I, conserved site
CL 1.5.3.2 Folic acid GO:0046656
EC
GO InterPro
Biological Process: tetrahydrofolate biosynthetic process (GO:0046654)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: GTP cyclohydrolase I activity (GO:0003934)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100412)
MW 22625.6 Da
SQ 200 aa
 
........10........20........30........40........50
| | | | |
MSQSNQPDSPVTQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDW
FSGYRDEPREYLERTFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHV
GYLPRGKVVGISKLARVVESYARRFQVQEKMTAQIAQCIQDVLQPLGVGV
VVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAEFLQFIEVGGKR
XFF4834R

NP_644596.1 lcl|folE-XAC4302

1

200

S=1062 I=100 E=7.42301e-122

GTP cyclohydrolase I

XFF4834R

YP_366133.1 lcl|folE-XCV4402

1

200

S=1047 I=99 E=4.7093e-120

GTP cyclohydrolase I

XFF4834R

NP_639500.1 lcl|folE-XCC4166

1

200

S=1019 I=97 E=1.0661e-116

GTP cyclohydrolase I

XFF4834R

lcl|folE-XALc_3129

1

199

S=916 I=85 E=2.95295e-104

probable gtp cyclohydrolaseIprotein

pubmed

12

194

S=552 I=54 E=1.35061e-58

GTP synthase

Pubmed 12730156

 

prodomImg

pubmed

11

195

S=501 I=51 E=2.28734e-52

GTP cyclohydrolase 1 EC=3.5.4.16 ; GTP-binding Metal-binding Nucleotide-binding One-carbon metabolism Zinc

Pubmed 2123343

 

prodomImg

pubmed

19

195

S=488 I=53 E=8.09116e-51

GTP cyclohydrolase I EC=3.5.4.16 ; GTP-binding Nucleotide-binding

Pubmed 18043661

 

prodomImg

pubmed

8

194

S=472 I=48 E=7.66596e-49

GTP cyclohydrolase 1 EC=3.5.4.16 ; Allosteric enzyme Cytoplasm GTP-binding Metal-binding Nucleotide-binding Nucleus Phosphoprotein Tetrahydrobiopteri

Pubmed 1985963,7802677

 

prodomImg

pubmed

17

195

S=471 I=52 E=9.87132e-49

GTP cyclohydrolase 1 EC=3.5.4.16 ; Allosteric enzyme GTP-binding Metal-binding Nucleotide-binding Tetrahydrobiopterin biosynthesis Zinc

Pubmed 8870645

 

prodomImg

pubmed

8

194

S=470 I=48 E=1.3048e-48

GTP cyclohydrolase 1 EC=3.5.4.16 ; Allosteric enzyme Cytoplasm GTP-binding Metal-binding Nucleotide-binding Nucleus Tetrahydrobiopterin biosynthesis Zin

Pubmed 7542887

 

prodomImg

pubmed

19

194

S=469 I=52 E=1.91492e-48

GTP cyclohydrolase 1 EC=3.5.4.16 ; Allosteric enzyme GTP-binding Metal-binding Nucleotide-binding Phosphoprotein Tetrahydrobiopterin biosynthesis

Pubmed 8573145,9605509

 

prodomImg

pubmed

8

194

S=467 I=48 E=2.59823e-48

GTP cyclohydrolase I

Pubmed 11284739

 

prodomImg

pubmed

17

193

S=466 I=51 E=4.23371e-48

GTP cyclohydrolase I

Pubmed 11677059

 

prodomImg

pubmed

19

194

S=464 I=50 E=7.7943e-48

GTP cyclohydrolase 1 EC=3.5.4.16 ; Allosteric enzyme Cytoplasm GTP-binding Metal-binding Nucleotide-binding Nucleus Phosphoprotein Tetrahydrobio

Pubmed 8461009

 

prodomImg

sp_Pdown

sp|Q8PEP3|GCH1_XANAC

1

200

S=1060 I=100 E=3.17056e-120

GTP cyclohydrolase 1 EC=3.5.4.16 ; GTP-binding Metal-binding Nucleotide-binding One-carbon metabolism Zinc

sp_Pdown

sp|Q3BM80|GCH1_XANC5

1

200

S=1047 I=99 E=1.13137e-118

GTP cyclohydrolase 1 EC=3.5.4.16 ; GTP-binding Metal-binding Nucleotide-binding One-carbon metabolism Zinc

sp_Pdown

sp|Q8P3B0|GCH1_XANCP

1

200

S=1021 I=97 E=1.50477e-115

GTP cyclohydrolase 1 EC=3.5.4.16 ; GTP-binding Metal-binding Nucleotide-binding One-carbon metabolism Zinc

sp_Pdown

sp|Q9PC02|GCH1_XYLFA

1

197

S=925 I=85 E=6.17562e-104

GTP cyclohydrolase 1 EC=3.5.4.16 ; GTP-binding Metal-binding Nucleotide-binding One-carbon metabolism Zinc

sp_Pdown

sp|B0U794|GCH1_XYLFM

1

197

S=925 I=85 E=6.33928e-104

GTP cyclohydrolase 1 EC=3.5.4.16 ; GTP-binding Metal-binding Nucleotide-binding One-carbon metabolism Zinc

Iprscan [G3DSA:1.10.286.10]

2

61

-

Iprscan [G3DSA:3.30.1130.10]

63

198

-

Iprscan [PTHR11109]

21

194

-

Iprscan IPR020602 [PF01227]

93

178

GTP cyclohydrolase I/Nitrile oxidoreductase

Iprscan IPR001474 [TIGR00063]

16

196

GTP cyclohydrolase I

Iprscan IPR018234 [PS00860]

122

132

GTP cyclohydrolase I, conserved site

Iprscan IPR018234 [PS00859]

74

90

GTP cyclohydrolase I, conserved site

PD003330

19

194

S=551 I=58 E=3.20052e-59

PD859422

1

35

S=167 I=91 E=8.92259e-13

Iprscan [SSF55620]

5

196

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one z4Mi6nh2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

45 hits
swiss-prot

Swiss-Prot ncbi-blastp

325 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr41720.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr41720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr41720.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiJ2ATn/XFF4834R_chr41720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.