Xanthomonas fuscans subsp. fuscans

8 hits

  1. XFF4834R_chr09540ispEXFF4834R_chr095404-diphosphocytidyl-2-C-methylerythritol kinase
  2. XFF4834R_chr18700ispAXFF4834R_chr18700probable geranyltranstransferase
  3. XFF4834R_chr19280ispGXFF4834R_chr192801-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase
  4. XFF4834R_chr27890ispFXFF4834R_chr27890probable 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  5. XFF4834R_chr27900ispDXFF4834R_chr27900probable 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
  6. XFF4834R_chr30800ispUXFF4834R_chr30800probable secreted undecaprenyl pyrophosphate synthase protein
  7. XFF4834R_chr30820dxrXFF4834R_chr30820probable 1-deoxy-D-xylulose 5-phosphate reductoisomerase protein
  8. XFF4834R_chr32830ispHXFF4834R_chr32830probable 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein

ispE XFF4834R_chr09540
XFF4834R_chr09530
XFF4834R_chr09530
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09550
XFF4834R_chr09550
ID ispE
AC XFF4834R_chr09540
LT XFF4834R_chr09540
OR XFF4834R_chr from 1095939 to 1096826 on strand +
DE 4-diphosphocytidyl-2-C-methylerythritol kinase
IP 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
CL 1.5.3.19 Isoprenoid biosynthesis GO:0008299
EC
GO InterPro
Biological Process: phosphorylation (GO:0016310)
Biological Process: terpenoid biosynthetic process (GO:0016114)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: kinase activity (GO:0016301)
Molecular Function: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase activity (GO:0050515)

Curated
PM
AN la publi sur le fonctionnel est avec l ancien nom du gene YchB
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100723)
MW 31086 Da
SQ 295 aa
 
........10........20........30........40........50
| | | | |
MDRIALMDAPGSDWSAWPAPAKLNLFLQITGRRADGYHLLQTVFRLLDWG
DTVHLRVRRGGQIRRAGESLPGVAEDDDLVIRAARLLQSATGTQAGAEIR
VDKRIPAGGGFGGGSSDAATVLVALNALWGLGLAADALAELGLQLGADVP
VFVRGHNAWAEGVGEQLTPISLPEAAYLLVDPGVHVPTPALFRSQELTRD
AAPAKIADFASGSLLDNAFEPVLRRREPAVEAVFQALSRVGTPRLTGSGS
GCFVEFAMRAAAEQALAQLPGGLRAWVAEGASHSPLLDARDARQV
XFF4834R

NP_641300.1 lcl|ipk-XAC0948

1

295

S=1214 I=83 E=4.39664e-140

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase

XFF4834R

YP_362710.1 lcl|ispE-XCV0979

1

295

S=1158 I=80 E=2.39504e-133

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase

XFF4834R

NP_636262.1 lcl|ipk-XCC0871

1

295

S=1074 I=73 E=3.97274e-123

4-diphosphocytidyl-2-C-methyl-D-erythritolkinase

XFF4834R

lcl|ispE-XALc_0490

6

289

S=861 I=63 E=2.64883e-97

probable 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase protein

pubmed

14

295

S=746 I=59 E=1.01503e-81

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

Pubmed 19218412

 

prodomImg

pubmed

15

286

S=499 I=41 E=7.55469e-52

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

Pubmed 1427085,7679718

 

prodomImg

pubmed

15

286

S=491 I=41 E=7.48285e-51

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

Pubmed 7679718

 

prodomImg

pubmed

15

286

S=490 I=41 E=8.83102e-51

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

Pubmed 12878729

 

prodomImg

pubmed

18

286

S=467 I=41 E=6.05485e-48

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

Pubmed 7883699

 

prodomImg

sp_Pdown

sp|Q8PNU1|ISPE_XANAC

1

295

S=1214 I=83 E=1.2337e-138

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q3BX03|ISPE_XANC5

1

295

S=1158 I=80 E=6.72049e-132

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q5GWR3|ISPE_XANOR

1

295

S=1125 I=79 E=7.90485e-128

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q2NZW6|ISPE_XANOM

1

295

S=1125 I=79 E=7.90485e-128

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

sp_Pdown

sp|Q8PC64|ISPE_XANCP

1

295

S=1074 I=73 E=1.11475e-121

4-diphosphocytidyl-2-C-methyl-D-erythritol kinase EC=2.7.1.148 ; ATP-binding Isoprene biosynthesis Nucleotide-binding Transferase

Iprscan IPR014721 [G3DSA:3.30.230.10]

15

172

Ribosomal protein S5 domain 2-type fold, subgroup

Iprscan IPR004424 [MF_00061]

15

283

4-diphosphocytidyl-2C-methyl-D-erythritol kinase

Iprscan IPR004424 [PIRSF010376]

13

289

4-diphosphocytidyl-2C-methyl-D-erythritol kinase

Iprscan IPR004424 [PTHR20861:SF2]

58

269

4-diphosphocytidyl-2C-methyl-D-erythritol kinase

Iprscan [PTHR20861]

58

269

-

Iprscan IPR006204 [PF00288]

99

155

GHMP kinase

Iprscan IPR013750 [PF08544]

213

269

GHMP kinase, C-terminal

Iprscan IPR004424 [TIGR00154]

15

292

4-diphosphocytidyl-2C-methyl-D-erythritol kinase

Iprscan [seg]

108

114

-

Iprscan [seg]

122

147

-

Iprscan [seg]

260

269

-

PD250946

19

87

S=190 I=55 E=1.46354e-15

PDA0V337

178

282

S=150 I=35 E=1.22422e-10

PDA306I2

52

85

S=126 I=74 E=8.4672e-08

PDA2G7M9

270

295

S=106 I=81 E=2.18647e-05

Iprscan IPR020568 [SSF54211]

13

170

Ribosomal protein S5 domain 2-type fold

Iprscan [SSF55060]

171

291

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one PMvSHTkL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

27 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr09540.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr09540.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr09540.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr09540.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ispA XFF4834R_chr18700
XFF4834R_chr18690
XFF4834R_chr18690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr18710
XFF4834R_chr18710
ID ispA
AC XFF4834R_chr18700
LT XFF4834R_chr18700
OR XFF4834R_chr from 2141338 to 2142213 on strand -
DE probable geranyltranstransferase
IP Polyprenyl synthetase; Terpenoid synthase
CL 1.5.3.19 Isoprenoid biosynthesis GO:0008299
EC
GO InterPro
Biological Process: isoprenoid biosynthetic process (GO:0008299)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100408)
MW 30500.3 Da
SQ 291 aa
 
........10........20........30........40........50
| | | | |
VSSALFDRWIARTERSLEAGLPSATHAPQRLHAAMRHAVLGGGKRMRPLL
VYASGALFGAAEDQLDTPAVAVELIHAYSLVHDDLPAMDDDALRRGQPTV
HIAFDEATAILAGDALQTRAFELLATAPASAELRVGWMQSLANAAGAAGM
CGGQALDIDATGQLQSLQHLQRMHALKTGALIRAAVRMGALTGGAAAADQ
QRLDEFADALGLAFQVRDDILDVESSSAQLGKTAGKDAAQSKSTYPALLG
MDGAKAKLAELAARMHDVLQPYGQPGETLATLGRFAVNRAH
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr17330 lcl|ispB-XFF4834R_chr17330

37

260

S=267 I=34 E=6.31643e-26

octaprenyl diphosphate synthase

XFF4834R

XFF4834R_chr17330 lcl|ispB-XFF4834R_chr17330

37

260

S=267 I=34 E=6.31643e-26

octaprenyl diphosphate synthase

XFF4834R

NP_643071.1 lcl|ispA-XAC2762

1

291

S=1249 I=93 E=2.373e-144

farnesyl-diphosphate synthase

XFF4834R

YP_364647.1 lcl|ispA-XCV2916

1

291

S=1238 I=92 E=5.1515e-143

geranyltranstransferase

XFF4834R

NP_637948.1 lcl|ispA-XCC2600

1

291

S=1182 I=82 E=3.19833e-136

farnesyl-diphosphate synthase

XFF4834R

lcl|IspA-XALc_2454

3

291

S=949 I=70 E=4.95968e-108

putative geranylgeranyl pyrophosphate synthase protein

XFF4834R

YP_364781.1 lcl|ispB-XCV3050

37

251

S=269 I=35 E=1.42618e-25

octaprenyl-diphosphate synthase

XFF4834R

NP_643215.1 lcl|ispB-XAC2906

37

251

S=268 I=35 E=1.80472e-25

octaprenyl-diphosphate synthase

XFF4834R

lcl|XALc_1041

37

246

S=266 I=34 E=2.99244e-25

putative octaprenyl-diphosphate synthase protein

XFF4834R

NP_638084.1 lcl|ispB-XCC2736

37

248

S=256 I=35 E=5.3624e-24

octaprenyl-diphosphate synthase

pubmed

6

289

S=659 I=50 E=2.58428e-71

Farnesyl diphosphate synthase (SelFPS) ; Isoprene biosynthesis Transferase

Pubmed 10412909

 

prodomImg

pubmed

6

255

S=508 I=43 E=6.24915e-53

Geranyl diphosphate synthase large subunit Geranyl pyrophosphate synthase large subunit Gpp synthase large subunit ; Isoprene biosynthesis Transferase

Pubmed 10557273

 

prodomImg

pubmed

6

272

S=506 I=44 E=9.25153e-53

Geranylgeranyl diphosphate synthase EC=2.5.1.29 ; Isoprene biosynthesis Transferase

Pubmed 17634749

 

prodomImg

pubmed

12

272

S=504 I=42 E=1.58846e-52

Geranylgeranyl pyrophosphate synthase 1 ; Isoprene biosynthesis Transferase

Pubmed 16786318

 

prodomImg

pubmed

5

283

S=501 I=41 E=4.52228e-52

Geranylgeranyl diphosphate synthase ; Isoprene biosynthesis Transferase

Pubmed 15352294

 

prodomImg

pubmed

6

261

S=500 I=43 E=4.72378e-52

Geranylgeranyl pyrophosphate synthetase, chloroplastic EC=2.5.1.1 EC=2.5.1.10 EC=2.5.1.29 ; Carotenoid biosynthesis Isoprene Multifunctional enzym

Pubmed 1303794,7888631

 

prodomImg

pubmed

35

261

S=500 I=53 E=4.97747e-52

Geranyltranstransferase EC=2.5.1.10 ; Cytoplasm Isoprene biosynthesis

Pubmed 2089044

 

prodomImg

pubmed

22

289

S=498 I=48 E=8.472e-52

Farnesyl diphosphate synthase Polyprenyl synthetase ; Isoprene biosynthesis Transferase

Pubmed 12189420

 

prodomImg

pubmed

12

273

S=498 I=42 E=1.02633e-51

Putative geranylgeranyl pyrophosphate synthase ; Isoprene biosynthesis Transferase

Pubmed 17186217

 

prodomImg

pubmed

6

274

S=497 I=41 E=1.25423e-51

Geranylgeranyl diphosphate synthase ; Isoprene biosynthesis Transferase

Pubmed 9826430

 

prodomImg

sp_Pdown

sp|P45204|ISPA_HAEIN

12

261

S=531 I=49 E=7.16052e-56

Geranyltranstransferase EC=2.5.1.10 ; Cytoplasm Isoprene biosynthesis

sp_Pdown

sp|P80042|GGPPS_CAPAN

6

261

S=500 I=43 E=3.25618e-52

Geranylgeranyl pyrophosphate synthetase, chloroplastic EC=2.5.1.1 EC=2.5.1.10 EC=2.5.1.29 ; Carotenoid biosynthesis Isoprene Multifunctional enzym

sp_Pdown

sp|P22939|ISPA_ECOLI

35

261

S=500 I=53 E=3.43105e-52

Geranyltranstransferase EC=2.5.1.10 ; Cytoplasm Isoprene biosynthesis

sp_Pdown

sp|Q42698|GGPPS_CATRO

28

255

S=496 I=46 E=1.00269e-51

Geranylgeranyl pyrophosphate synthetase, chloroplastic EC=2.5.1.1 EC=2.5.1.10 EC=2.5.1.29 ; Carotenoid biosynthesis Isoprene Multifunctional enzyme Plastid Transfe

sp_Pdown

sp|O66126|ISPA_MICLU

17

289

S=496 I=40 E=1.26883e-51

Geranyltranstransferase EC=2.5.1.10 ; Cytoplasm Isoprene biosynthesis

PD000572

6

248

S=406 I=43 E=1.0632e-41

PDA4B0N2

199

291

S=169 I=43 E=5.34963e-13

PDA28265

267

291

S=135 I=100 E=7.17157e-09

PDA2H3P5

255

291

S=134 I=70 E=8.46365e-09

PD410808

166

248

S=132 I=37 E=1.90416e-08

PD122970

40

241

S=125 I=28 E=1.15747e-07

PD153235

4

48

S=121 I=52 E=3.95737e-07

PDA348W4

216

255

S=118 I=53 E=7.94926e-07

PDA4H3X7

71

104

S=102 I=59 E=6.49399e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one X1NBg7OB)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

127 hits
swiss-prot

Swiss-Prot ncbi-blastp

50 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr18700.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr18700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr18700.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr18700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ispG XFF4834R_chr19280
XFF4834R_chr19270
XFF4834R_chr19270
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4659
XFF4834R_chr_4659
ID ispG
AC XFF4834R_chr19280
LT XFF4834R_chr19280
OR XFF4834R_chr from 2207927 to 2209192 on strand +
DE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase
IP 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, bacterial-type
CL 1.5.3.19 Isoprenoid biosynthesis GO:0008299
EC
GO InterPro
Biological Process: terpenoid biosynthetic process (GO:0016114)
Biological Process: cellular metabolic process (GO:0044237)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: isoprenoid biosynthetic process (GO:0008299)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity (GO:0046429)

Curated
PM
AN s appelle aussi gcpE
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100812)
MW 45186.2 Da
SQ 421 aa
 
........10........20........30........40........50
| | | | |
MHDAVTRPTPPADATAWPRRITQAVKIGSVTVGGGHPVVVQSMTNTDTAD
IAGSVKQVADLWRAGSEMVRLTVNNAESAAAIPRIVDKLRMMGIEVPLIG
DFHYNGHQLLAAEPACAEALAKYRINPGNVGFGKKKDLQFGQLIEFAIKY
GKPVRIGANWGSLDQSLAAQLMDENSQRDTPWDAGRVLREALIRSAVDSA
ERAVELGLPRERIILSAKVSGVQELIAVYRDMASRCDFALHLGLTEAGIG
SKGIVASAAALSVLLQEGIGDTIRISLTPEPGQSRTQEVVVAQELLQTTG
QRAFTPMVTACPGCGRTTSEFFQELAGVVQNHVRARMPEWKISNPGAENM
TLAVMGCVVNGPGESRHANIGISLPGTGEAPSAPVFIDGEKSVTLRGENI
AYEFIELIDQYVERTYVRRVG
XFF4834R

YP_363560.1 lcl|ispG-XCV1829

1

421

S=2083 I=94 E=0

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase

XFF4834R

NP_642126.1 lcl|ispG-XAC1799

1

421

S=2078 I=93 E=0

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase

XFF4834R

NP_637147.1 lcl|ispG-XCC1781

1

421

S=2013 I=89 E=0

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase

XFF4834R

lcl|ispG-XALc_1214

1

421

S=1838 I=82 E=0

probable 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase) protein

pubmed

19

416

S=1144 I=54 E=7.88945e-130

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

Pubmed 12482607

 

prodomImg

pubmed

13

416

S=1000 I=48 E=2.41617e-112

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

Pubmed 18550617

 

prodomImg

pubmed

20

416

S=997 I=48 E=5.06967e-112

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

Pubmed 15618402

 

prodomImg

pubmed

19

416

S=989 I=48 E=5.29115e-111

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

Pubmed 15780005

 

prodomImg

pubmed

19

416

S=988 I=48 E=7.17923e-111

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

Pubmed 19307581

 

prodomImg

sp_Pdown

sp|Q3BUK3|ISPG_XANC5

1

421

S=2083 I=94 E=0

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

sp_Pdown

sp|Q8PLJ8|ISPG_XANAC

1

421

S=2078 I=93 E=0

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

sp_Pdown

sp|Q2P3M7|ISPG_XANOM

1

421

S=2014 I=90 E=0

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

sp_Pdown

sp|Q8P9R7|ISPG_XANCP

1

421

S=2013 I=89 E=0

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

sp_Pdown

sp|B0RTS9|ISPG_XANCB

1

421

S=2013 I=89 E=0

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase EC=1.17.7.1 ; 4Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding Oxidoreductase

Iprscan IPR004588 [MF_00159]

17

411

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, bacterial-type

Iprscan IPR016425 [PIRSF004640]

15

420

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, bacterial

Iprscan IPR004588 [PF04551]

22

411

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, bacterial-type

Iprscan IPR004588 [TIGR00612]

19

409

4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, bacterial-type

Iprscan [seg]

109

121

-

Iprscan [seg]

255

265

-

PD008743

54

371

S=397 I=34 E=1.1681e-40

PD882956

374

416

S=166 I=70 E=1.44398e-12

PDA1F7A8

19

51

S=111 I=64 E=6.66515e-06

Iprscan IPR011005 [SSF51717]

20

299

Dihydropteroate synthase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3BUqK2mo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

35 hits
swiss-prot

Swiss-Prot ncbi-blastp

447 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr19280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr19280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr19280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr19280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ispF XFF4834R_chr27890
XFF4834R_chr27880
XFF4834R_chr27880
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27900
XFF4834R_chr27900
ID ispF
AC XFF4834R_chr27890
LT XFF4834R_chr27890
OR XFF4834R_chr from 3217021 to 3217521 on strand -
DE probable 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
IP 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, core
CL 1.5.3.19 Isoprenoid biosynthesis GO:0008299
EC
GO InterPro
4-cyclodiphosphate synthase activity (GO:0008685)
Biological Process: terpenoid biosynthetic process (GO:0016114)

Curated
PM
AN
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: validated by jacques (20110713)
MW 17518.9 Da
SQ 166 aa
 
........10........20........30........40........50
| | | | |
MSFNFRIGQGYDVHAFGPGDHVMLGGVRVAHSHGVLAHSDGDVVLHALCD
AMLGALALGDIGLHFPPSDARWKDADSAQFLQHCDGLLRERGWCVGNADI
TVICERPKVGPHAVVMRERIAGLLAIELDAVSVKATTSEQLGFTGRGEGI
AAQAAVLLGRIAAPHQ
Show or not Domain decomposition
 
XFF4834R

NP_642053.1 lcl|ispF-XAC1722

1

166

S=829 I=98 E=9.49487e-94

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

XFF4834R

YP_363486.1 lcl|ispF-XCV1755

1

166

S=828 I=97 E=1.11083e-93

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

XFF4834R

NP_637073.1 lcl|ispF-XCC1703

1

163

S=774 I=91 E=4.3069e-87

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

XFF4834R

lcl|ispF-XALc_1154

5

158

S=667 I=84 E=4.11438e-74

probable 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (mecdp-synthase) protein

pubmed

1

158

S=485 I=61 E=1.41224e-50

Bifunctional enzyme ispD/ispF EC=2.7.7.60 EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding Multifunctional Nucleotidyltransferase

Pubmed 8355615

 

prodomImg

pubmed

8

154

S=471 I=59 E=7.79291e-49

Bifunctional enzyme ispD/ispF EC=2.7.7.60 EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding Multifunctional Nucleotidyltransferase

Pubmed 10419959

 

prodomImg

pubmed

5

160

S=430 I=51 E=6.69138e-44

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding

Pubmed 7510287,7584024

 

prodomImg

pubmed

5

157

S=427 I=50 E=1.68611e-43

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding

Pubmed 16707693

 

prodomImg

pubmed

5

166

S=418 I=47 E=2.15053e-42

Bifunctional enzyme ispD/ispF EC=2.7.7.60 EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding Multifunctional Nucleotidyltransferase

Pubmed 15780005

 

prodomImg

sp_Pdown

sp|Q8PLR7|ISPF_XANAC

1

166

S=829 I=98 E=2.38784e-92

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding

sp_Pdown

sp|Q3BUS7|ISPF_XANC5

1

166

S=828 I=97 E=2.79359e-92

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding

sp_Pdown

sp|Q5GYK7|ISPF_XANOR

1

163

S=808 I=97 E=7.405e-90

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding

sp_Pdown

sp|B2SUA9|ISPF_XANOP

1

163

S=808 I=97 E=7.405e-90

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding

sp_Pdown

sp|Q2P1L1|ISPF_XANOM

1

163

S=808 I=97 E=7.405e-90

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase EC=4.6.1.12 ; Isoprene biosynthesis Lyase Metal-binding

Iprscan IPR003526 [G3DSA:3.30.1330.50]

5

156

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, core

Iprscan IPR003526 [MF_00107]

5

160

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, core

Iprscan IPR003526 [PF02542]

5

159

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, core

Iprscan IPR003526 [TIGR00151]

6

160

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, core

Iprscan IPR020555 [PS01350]

39

54

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, conserved site

PD006214

11

153

S=460 I=60 E=2.87179e-48

Iprscan IPR003526 [SSF69765]

5

159

2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jeeK1aPi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

38 hits
swiss-prot

Swiss-Prot ncbi-blastp

525 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr27890.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr27890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr27890.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr27890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ispD XFF4834R_chr27900
XFF4834R_chr27890
XFF4834R_chr27890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27910
XFF4834R_chr27910
ID ispD
AC XFF4834R_chr27900
LT XFF4834R_chr27900
OR XFF4834R_chr from 3217525 to 3218304 on strand -
DE probable 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
IP 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
CL 1.5.3.19 Isoprenoid biosynthesis GO:0008299
EC
GO InterPro
Biological Process: isoprenoid biosynthetic process (GO:0008299)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100813)
MW 27181.7 Da
SQ 259 aa
 
........10........20........30........40........50
| | | | |
MTGSIWAIVPAAGRGTRFGGPLPKQYLQAGGQPLMAYTLAALAAHPALAG
IMVAIAPGDADWPGWTAVQSKPVLTCLGGATRAASVLAGLLALPESVRAD
DFVLVHDAARPNLALADLDRLLEIGRGDPVGAILAAPVRDTLKRAGDDGG
IDGTEPRERLWRALTPQLFRRHQLIRGLTEASAAGVDVTDEAMAMERMGL
RPLLVEGAEDNFKVTTPADLARFAFELASRDCGPGTRDPESAHPQWPVSA
SAFSGPEEI
XFF4834R

NP_642052.1 lcl|ispD-XAC1721

1

256

S=1116 I=91 E=2.92637e-128

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

XFF4834R

YP_363485.1 lcl|ispD-XCV1754

1

256

S=1049 I=88 E=3.6465e-120

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

XFF4834R

NP_637072.1 lcl|ispD-XCC1702

1

259

S=973 I=80 E=5.40495e-111

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

XFF4834R

lcl|ispD-XALc_1153

13

234

S=754 I=73 E=2.1906e-84

probable 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (4-diphosphocytidyl-2c-methyl-d-erythritol synthase) (mep cytidylyltransferase) (mct) protein

pubmed

5

227

S=382 I=44 E=1.05251e-37

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase EC=2.7.7.60 ; Cobalt Isoprene biosynthesis Magnesium Manganese Nucleotidyltransferase

Pubmed 10518523

 

prodomImg

pubmed

5

220

S=242 I=32 E=8.12899e-21

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase ; Nucleotidyltransferase

Pubmed 16828818

 

prodomImg

pubmed

7

220

S=241 I=33 E=1.33619e-20

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase EC=2.7.7.60 ; Isoprene biosynthesis Nucleotidyltransferase

Pubmed 18043661

 

prodomImg

pubmed

4

220

S=240 I=31 E=1.47068e-20

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase EC=2.7.7.60 ; Nucleotidyltransferase

Pubmed 18997428

 

prodomImg

pubmed

4

220

S=238 I=31 E=3.14011e-20

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase EC=2.7.7.60 ; Nucleotidyltransferase

Pubmed 18997428

 

prodomImg

sp_Pdown

sp|Q8PLR8|ISPD_XANAC

1

256

S=1116 I=91 E=8.07228e-127

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase EC=2.7.7.60 ; Isoprene biosynthesis Nucleotidyltransferase

sp_Pdown

sp|Q3BUS8|ISPD_XANC5

1

256

S=1049 I=88 E=1.00587e-118

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase EC=2.7.7.60 ; Isoprene biosynthesis Nucleotidyltransferase

sp_Pdown

sp|Q2P1L0|ISPD_XANOM

3

230

S=982 I=91 E=1.47923e-110

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase EC=2.7.7.60 ; Isoprene biosynthesis Nucleotidyltransferase

sp_Pdown

sp|Q5GYK6|ISPD_XANOR

3

230

S=981 I=91 E=1.57232e-110

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase EC=2.7.7.60 ; Isoprene biosynthesis Nucleotidyltransferase

sp_Pdown

sp|B2SUA8|ISPD_XANOP

3

230

S=981 I=91 E=1.57232e-110

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase EC=2.7.7.60 ; Isoprene biosynthesis Nucleotidyltransferase

Iprscan [G3DSA:3.90.550.10]

5

236

-

Iprscan IPR001228 [MF_00108]

4

230

4-diphosphocytidyl-2C-methyl-D-erythritol synthase

Iprscan IPR001228 [PF01128]

6

225

4-diphosphocytidyl-2C-methyl-D-erythritol synthase

Iprscan IPR001228 [TIGR00453]

6

227

4-diphosphocytidyl-2C-methyl-D-erythritol synthase

Iprscan IPR018294 [PS01295]

103

110

4-diphosphocytidyl-2C-methyl-D-erythritol synthase, conserved site

Iprscan [seg]

34

49

-

PD695369

157

221

S=145 I=50 E=4.35026e-10

PDA38448

225

256

S=143 I=88 E=8.07899e-10

PDA1V5D2

124

150

S=128 I=100 E=5.12547e-08

PD105392

70

143

S=126 I=46 E=9.77091e-08

PDA38432

50

75

S=114 I=85 E=2.73137e-06

PDA38430

50

69

S=103 I=100 E=5.67654e-05

Iprscan [SSF53448]

1

229

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one aZIkCdb4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

28 hits
swiss-prot

Swiss-Prot ncbi-blastp

461 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr27900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr27900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr27900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr27900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ispU XFF4834R_chr30800
XFF4834R_chr30790
XFF4834R_chr30790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30810
XFF4834R_chr30810
ID ispU
AC XFF4834R_chr30800
LT XFF4834R_chr30800
OR XFF4834R_chr from 3543698 to 3544459 on strand +
DE probable secreted undecaprenyl pyrophosphate synthase protein
IP Di-trans-poly-cis-decaprenylcistransferase-like
CL 1.5.3.19 Isoprenoid biosynthesis GO:0008299
EC
GO InterPro
transferring alkyl or aryl (other than methyl) groups (GO:0016765)

Curated
PM
AN changement de start moins 5 aa
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100816)
MW 27997.3 Da
SQ 253 aa
 
........10........20........30........40........50
| | | | |
MHPVPSAANVPRHIAIIMDGNGRWAQRRRRPRVIGHRAGARAVNRTIDFC
LEKGVSALTLFAFSSENWGRPQDEVDALMKLFLHALDREVEELQRRGVQV
RFIGDRSRFAAPLRDRMAGAERSTAANSRLVLSIAASYGGRQDIAAAARA
LAEDVAAGRLQPEQIDEALLSSRVALADLPAPDLFIRTGGDTRISNFLLW
QLAYTELWFTETLWPEFDAGVLQQALDDYAGRERRFGLTSAQIADKATES
SSA
Show or not Domain decomposition
 
XFF4834R

NP_641752.1 lcl|uppS-XAC1417

1

253

S=1176 I=94 E=1.54673e-135

undecaprenyl pyrophosphate synthetase

XFF4834R

YP_363205.1 lcl|uppS-XCV1474

1

253

S=1165 I=93 E=3.50738e-134

undecaprenyl pyrophosphate synthetase

XFF4834R

NP_636743.1 lcl|uppS-XCC1369

1

253

S=1147 I=90 E=5.18383e-132

undecaprenyl pyrophosphate synthetase

XFF4834R

lcl|uppS-XALc_2030

1

250

S=951 I=77 E=2.64216e-108

probable undecaprenyl pyrophosphate synthase protein

pubmed

10

237

S=596 I=49 E=1.11112e-63

Undecaprenyl pyrophosphate synthase EC=2.5.1.31 ; Cell cycle division shape wall biogenesis/degradation Peptidoglycan synthesis Transferase

Pubmed 12446909

 

prodomImg

pubmed

7

237

S=548 I=46 E=8.07735e-58

Undecaprenyl pyrophosphate synthase EC=2.5.1.31 ; Cell cycle division shape wall biogenesis/degradation Peptidoglycan synthesis Transferase

Pubmed 12955602

 

prodomImg

pubmed

10

237

S=540 I=46 E=6.48999e-57

Undecaprenyl pyrophosphate synthase EC=2.5.1.31 ; Transferase

Pubmed 18459973

 

prodomImg

pubmed

11

237

S=518 I=48 E=3.60961e-54

Undecaprenyl-diphosphate synthase EC=2.5.1.31 ; Transferase

Pubmed 12384294

 

prodomImg

pubmed

6

237

S=493 I=40 E=3.2429e-51

Undecaprenyl pyrophosphate synthase EC=2.5.1.31 ; Cell cycle division shape wall biogenesis/degradation Peptidoglycan synthesis Transferase

Pubmed 9677368,3182755

 

prodomImg

sp_Pdown

sp|Q8PMK9|UPPS_XANAC

1

253

S=1176 I=94 E=4.251e-134

Undecaprenyl pyrophosphate synthase EC=2.5.1.31 ; Cell cycle division shape wall biogenesis/degradation Peptidoglycan synthesis Transferase

sp_Pdown

sp|Q5H1E5|UPPS_XANOR

1

253

S=1173 I=92 E=9.99008e-134

Undecaprenyl pyrophosphate synthase EC=2.5.1.31 ; Cell shape wall biogenesis/degradation Peptidoglycan synthesis Transferase

sp_Pdown

sp|Q8PAV7|UPPS_XANCP

1

253

S=1147 I=90 E=1.42471e-130

Undecaprenyl pyrophosphate synthase EC=2.5.1.31 ; Cell cycle division shape wall biogenesis/degradation Peptidoglycan synthesis Transferase

sp_Pdown

sp|Q87EH7|UPPS_XYLFT

1

253

S=862 I=63 E=4.98899e-96

Undecaprenyl pyrophosphate synthase EC=2.5.1.31 ; Cell cycle division shape wall biogenesis/degradation Peptidoglycan synthesis Transferase

sp_Pdown

sp|Q9PEH8|UPPS_XYLFA

1

253

S=859 I=63 E=9.67804e-96

Undecaprenyl pyrophosphate synthase EC=2.5.1.31 ; Cell cycle division shape wall biogenesis/degradation Peptidoglycan synthesis Transferase

Iprscan IPR001441 [G3DSA:3.40.1180.10]

1

246

Di-trans-poly-cis-decaprenylcistransferase-like

Iprscan IPR001441 [MF_01139]

8

238

Di-trans-poly-cis-decaprenylcistransferase-like

Iprscan IPR001441 [PTHR10291]

4

237

Di-trans-poly-cis-decaprenylcistransferase-like

Iprscan IPR001441 [PF01255]

17

237

Di-trans-poly-cis-decaprenylcistransferase-like

Iprscan IPR001441 [TIGR00055]

10

237

Di-trans-poly-cis-decaprenylcistransferase-like

Iprscan IPR018520 [PS01066]

183

200

Di-trans-poly-cis-decaprenylcistransferase-like, conserved site

Iprscan [seg]

145

157

-

PD003461

12

232

S=467 I=46 E=3.7467e-49

Iprscan IPR001441 [SSF64005]

6

233

Di-trans-poly-cis-decaprenylcistransferase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pEhZTKsX)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

27 hits
swiss-prot

Swiss-Prot ncbi-blastp

205 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr30800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr30800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr30800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr30800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
dxr XFF4834R_chr30820
XFF4834R_chr30810
XFF4834R_chr30810
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30830
XFF4834R_chr30830
ID dxr
AC XFF4834R_chr30820
LT XFF4834R_chr30820
OR XFF4834R_chr from 3545286 to 3546476 on strand +
DE probable 1-deoxy-D-xylulose 5-phosphate reductoisomerase protein
IP 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NAD(P)-binding domain
CL 1.5.3.19 Isoprenoid biosynthesis GO:0008299
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: isoprenoid biosynthetic process (GO:0008299)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: 1-deoxy-D-xylulose-5-phosphate reductoisomerase activity (GO:0030604)
Molecular Function: metal ion binding (GO:0046872)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN ai fait unblastP avec dxr coli car le blast n apparait pas chez NCBI en blastX existe aussi sous le nom ispC
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: validated by jacques (20110713)
MW 40920.3 Da
SQ 396 aa
 
........10........20........30........40........50
| | | | |
MAGSSPRQVAVFGATGSIGTSALDVIARHPERLRASVLSAGSKVDELLAL
CATHRPAHALIADATLYPALRDGLRALGLATQAHAGAEALDALASSDACD
TVVAAIVGAAGLPSTLAAARAGKRLLLANKESLVLAGELLTRTAAAAGAE
IIPIDSEHSAIFQCLRSCDASRGVRRVILTASGGPFRGRDRAALAAVTPA
QAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGEQIDVLVHPQS
LVHSLVEFVDGSTLAQLGLPDMRTTLAVGLAWPERVDSGVAGLDLLTQGQ
LDFEAPDTAAFPCLRLAWDALRAGGTAPAILNAANEVAVSAFLQGKVGFL
AIPALVEHTLTTLQRHNADSLDTLLFADAQARQITERALAHHALHA
XFF4834R

NP_641750.1 lcl|dxr-XAC1415

1

396

S=1694 I=85 E=0

1-deoxy-D-xylulose 5-phosphate reductoisomerase

XFF4834R

YP_363203.1 lcl|dxr-XCV1472

1

396

S=1659 I=84 E=0

1-deoxy-D-xylulose 5-phosphate reductoisomerase

XFF4834R

NP_636741.1 lcl|dxr-XCC1367

1

396

S=1591 I=80 E=0

1-deoxy-D-xylulose 5-phosphate reductoisomerase

XFF4834R

lcl|dxr-XALc_2032

7

396

S=1272 I=67 E=6.77422e-147

probable 1-deoxy-d-xylulose 5-phosphate reductoisomerase protein

pubmed

4

393

S=820 I=46 E=1.49027e-90

1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Isoprene biosynthesis Metal-binding NADP Oxidoreductase

Pubmed 11034300

 

prodomImg

pubmed

4

382

S=789 I=44 E=7.459e-87

1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Cobalt Isoprene biosynthesis Magnesium Manganese Metal-binding NADP Oxidoreductase

Pubmed 11004410

 

prodomImg

pubmed

7

386

S=732 I=43 E=7.41553e-80

Putative plastid 1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Oxidoreductase Transit peptide

Pubmed 18799712

 

prodomImg

pubmed

7

389

S=730 I=38 E=1.0883e-79

1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Isoprene biosynthesis Metal-binding NADP Oxidoreductase

Pubmed 18391199

 

prodomImg

pubmed

7

386

S=729 I=43 E=1.59718e-79

Chloroplast 1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Oxidoreductase

Pubmed 18040591

 

prodomImg

sp_Pdown

sp|Q8PML1|DXR_XANAC

1

396

S=1694 I=85 E=0

1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Isoprene biosynthesis Metal-binding NADP Oxidoreductase

sp_Pdown

sp|Q3BVL0|DXR_XANC5

1

396

S=1659 I=84 E=0

1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Isoprene biosynthesis Metal-binding NADP Oxidoreductase

sp_Pdown

sp|B2SR05|DXR_XANOP

1

396

S=1630 I=82 E=0

1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Isoprene biosynthesis Metal-binding NADP Oxidoreductase

sp_Pdown

sp|Q5H1E7|DXR_XANOR

1

396

S=1629 I=82 E=0

1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Isoprene biosynthesis Metal-binding NADP Oxidoreductase

sp_Pdown

sp|Q2P4B2|DXR_XANOM

1

396

S=1629 I=82 E=0

1-deoxy-D-xylulose 5-phosphate reductoisomerase EC=1.1.1.267 ; Isoprene biosynthesis Metal-binding NADP Oxidoreductase

Iprscan IPR003821 [MF_00183]

9

388

1-deoxy-D-xylulose 5-phosphate reductoisomerase

Iprscan IPR003821 [PIRSF006205]

6

395

1-deoxy-D-xylulose 5-phosphate reductoisomerase

Iprscan IPR013512 [PF02670]

9

137

1-deoxy-D-xylulose 5-phosphate reductoisomerase, N-terminal

Iprscan IPR013644 [PF08436]

151

235

1-deoxy-D-xylulose 5-phosphate reductoisomerase, C-terminal

Iprscan IPR003821 [TIGR00243]

7

394

1-deoxy-D-xylulose 5-phosphate reductoisomerase

Iprscan [seg]

69

80

-

Iprscan [seg]

83

98

-

Iprscan [seg]

116

128

-

Iprscan [seg]

192

204

-

PD833444

99

226

S=312 I=49 E=2.54359e-30

PD580160

305

384

S=227 I=57 E=5.15602e-20

PDA092I6

225

268

S=162 I=64 E=3.61371e-12

PDA3A7T9

176

224

S=128 I=47 E=5.42585e-08

PDA1B5R2

227

286

S=126 I=43 E=9.07552e-08

PD010039

7

48

S=123 I=52 E=2.00652e-07

PDA0W2U5

267

304

S=118 I=61 E=8.45701e-07

PDA1L398

48

68

S=104 I=95 E=3.6241e-05

Iprscan [SSF55347]

131

270

-

Iprscan IPR016040 [SSF51735]

5

155

NAD(P)-binding domain

Iprscan [SSF69055]

297

391

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one IHRFEi8u)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

65 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr30820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr30820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr30820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUZX4b2/XFF4834R_chr30820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ispH XFF4834R_chr32830
XFF4834R_chr32820
XFF4834R_chr32820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32840
XFF4834R_chr32840
ID ispH
AC XFF4834R_chr32830
LT XFF4834R_chr32830
OR XFF4834R_chr from 3780611 to 3781561 on strand -
DE probable 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein
IP LytB protein
CL 1.5.3.19 Isoprenoid biosynthesis GO:0008299
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
mevalonate-independent pathway (GO:0019288)

Curated
PM
AN lytB = ispH
CC COG: [IM] Lipid transport and metabolism;Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100823)
MW 34718 Da
SQ 316 aa
 
........10........20........30........40........50
| | | | |
MDVLLANPRGFCAGVDRAIEIVKRAIETLGAPIYVRHEVVHNRFVVDDLK
QRGAIFVEELDEVPDDATVIFSAHGVSQAVRQEAERRGLKVFDATCPLVT
KVHFEVARHCRAGRDVVLIGHAGHPEVEGTMGQWSRERGVGTIYLVEDIE
QVATLDVRQPDNLAYTTQTTLSVDDTMGIIEALRARYPAMQGPRHDDICY
ATQNRQDAVRDLARQCDLVLVVGSPNSSNSNRLSELARRDGVESYLIDNA
SEIDPAWIVGKQHIGLTAGASAPQVLVDGVLERLRELGAAGVSELEGEPE
SMVFALPKELRLRLVS
XFF4834R

NP_641592.1 lcl|ispH-XAC1256

1

316

S=1651 I=100 E=0

4-hydroxy-3-methylbut-2-enyl diphosphate reductase

XFF4834R

YP_363023.2 lcl|ispH-XCV1292

1

316

S=1641 I=99 E=0

4-hydroxy-3-methylbut-2-enyl diphosphate reductase

XFF4834R

NP_636532.1 lcl|ispH-XCC1157

1

316

S=1594 I=97 E=0

4-hydroxy-3-methylbut-2-enyl diphosphate reductase

XFF4834R

lcl|ispH-XALc_0924

1

315

S=1528 I=92 E=4.7237e-178

probable 4-hydroxy-3-methylbut-2-enyl diphosphate reductase protein

pubmed

1

314

S=1137 I=66 E=4.16836e-129

4-hydroxy-3-methylbut-2-enyl diphosphate reductase EC=1.17.1.2 ; 3Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding NADP Oxidoreductase

Pubmed 10763755

 

prodomImg

pubmed

1

313

S=1111 I=69 E=5.89302e-126

4-hydroxy-3-methylbut-2-enyl diphosphate reductase EC=1.17.1.2 ; 3Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding NADP Oxidoreductase

Pubmed 14983043

 

prodomImg

pubmed

2

310

S=1043 I=63 E=1.19655e-117

4-hydroxy-3-methylbut-2-enyl diphosphate reductase EC=1.17.1.2 ; 3Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding NADP Oxidoreductase

Pubmed 18065615

 

prodomImg

pubmed

1

312

S=1023 I=63 E=2.83184e-115

4-hydroxy-3-methylbut-2-enyl diphosphate reductase EC=1.17.1.2 ; 3Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding NADP Oxidoreductase

Pubmed 11818558,2011499

 

prodomImg

pubmed

9

288

S=969 I=68 E=1.07898e-108

LytB

Pubmed 16318732

 

prodomImg

sp_Pdown

sp|Q8PN17|ISPH_XANAC

1

316

S=1651 I=100 E=0

4-hydroxy-3-methylbut-2-enyl diphosphate reductase EC=1.17.1.2 ; 3Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding NADP Oxidoreductase

sp_Pdown

sp|Q3BW40|ISPH_XANC5

1

316

S=1640 I=99 E=0

4-hydroxy-3-methylbut-2-enyl diphosphate reductase EC=1.17.1.2 ; 3Fe-4S Iron Iron-sulfur Isoprene biosynthesis Metal-binding NADP Oxidoreductase