Xanthomonas fuscans subsp. fuscans

9 hits

  1. XFF4834R_chr13090cysGXFF4834R_chr13090probable siroheme synthase
  2. XFF4834R_chr14390btuRXFF4834R_chr14390probable cob(I)alamin adenosyltransferase
  3. XFF4834R_chr14400cobDXFF4834R_chr14400putative cobalamin biosynthesis protein
  4. XFF4834R_chr14420cobQXFF4834R_chr14420putative cobyric acid synthase
  5. XFF4834R_chr14430cobUXFF4834R_chr14430probable bifunctional cobinamide kinase/ cobinamide phosphate guanylyltransferase
  6. XFF4834R_chr14440cobTXFF4834R_chr14440probable nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  7. XFF4834R_chr14450cobCXFF4834R_chr14450putative alpha-ribazole-5'-phosphate phosphatase
  8. XFF4834R_chr14460cobSXFF4834R_chr14460probable cobalamin synthase
  9. XFF4834R_chr22750XFF4834R_chr22750putative siroheme synthase

cysG XFF4834R_chr13090
XFF4834R_chr13080
XFF4834R_chr13080
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13100
XFF4834R_chr13100
ID cysG
AC XFF4834R_chr13090
LT XFF4834R_chr13090
OR XFF4834R_chr from 1490594 to 1491865 on strand -
DE probable siroheme synthase
IP Tetrapyrrole methylase; Uroporphiryn-III C-methyltransferase, conserved site; Sirohaem synthase, N-terminal; Tetrapyrrole methylase, subdomain 2; NAD(P)-binding domain
CL 1.5.3.13 Cobalamin (Vitamin B12) GO:0009236
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Biological Process: porphyrin biosynthetic process (GO:0006779)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: methyltransferase activity (GO:0008168)
Molecular Function: binding (GO:0005488)

Curated
PM
AN Including the following 3 domains:Uroporphyrinogen-III C-methyltransferase, Precorrin-2 dehydrogenase and Sirohydrochlorin ferrochelatase
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 44338.3 Da
SQ 423 aa
 
........10........20........30........40........50
| | | | |
MKSFPTAISQRYGLALPQRCCQTVTPAFPLLADLRGRAVLVVGGGADAER
ATGQLLQAGALPLVGAPELSAQLRHWAQAGRLRWLAGRFDPAWLAQSDQP
LWLTIAASESAALNDALRQAASAHRLLTHAAAPAASATVPARSAGSRSAI
GTLVPGNVSLVGAGPGDPGLLTRHALRALRQAEVVLHDRLVSPQILRLAR
QGARLIEVGKSAQGHSTRQEQIHALMLEHARAGRRVVRLKGGDPFVFGRG
GEELEFLCAHGIGFQVIPGITAAIACAAYAGIPLTHRDHAQSLRLITAHC
KDSLDTLDWQALGQERQTLAFYMGVAGLDAIQQRLLQAGRAASTPFALVE
NGSRPQQRVITGTLASLAASARQHAVTAPALLILGEVTALAQTLHWFGSA
PLSASSPHSPGATPHTPTLAHAA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr22750 lcl|XFF4834R_chr_2633995_2634966_f1_XFF4834R-XFF4834R_chr22750

156

242

S=116 I=43 E=1.83597e-07

XFF4834R

XFF4834R_chr22750 lcl|XFF4834R_chr_2633995_2634966_f1_XFF4834R-XFF4834R_chr22750

156

242

S=116 I=43 E=1.83597e-07

XFF4834R

NP_643647.1 lcl|cysG-XAC3340

1

398

S=1627 I=83 E=0

siroheme synthase

XFF4834R

YP_365189.1 lcl|cysG-XCV3458

24

398

S=1462 I=81 E=6.36094e-170

siroheme synthase

XFF4834R

NP_638527.1 lcl|cysG-XCC3181

24

398

S=1251 I=69 E=2.51359e-144

siroheme synthase

XFF4834R

YP_363827.1 lcl|XCV2096

157

385

S=343 I=41 E=2.68261e-34

putative siroheme synthase

XFF4834R

NP_637375.1 lcl|cysG-XCC2010

157

371

S=341 I=44 E=4.2214e-34

uroporphyrin-III C-methyltransferase

XFF4834R

NP_642474.1 lcl|cysG-XAC2157

216

325

S=188 I=41 E=1.47221e-15

uroporphyrin-III C-methyltransferase

XFF4834R

NP_637368.1 lcl|cysG-XCC2003

156

245

S=120 I=42 E=2.28129e-07

siroheme synthase

XFF4834R

NP_637368.1 lcl|cysG-XCC2003

26

121

S=107 I=35 E=1.00352e-05

siroheme synthase

XFF4834R

NP_642476.1 lcl|cysG-XAC2159

156

204

S=113 I=55 E=1.66535e-06

siroheme synthase

XFF4834R

YP_363820.1 lcl|XCV2089

156

204

S=113 I=55 E=1.67993e-06

putative siroheme synthase

XFF4834R

YP_363820.1 lcl|XCV2089

26

121

S=101 I=33 E=4.94829e-05

putative siroheme synthase

pubmed

156

371

S=741 I=68 E=5.12047e-81

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

pubmed

49

114

S=171 I=50 E=6.11675e-12

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

pubmed

156

371

S=740 I=68 E=8.27118e-81

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

pubmed

49

114

S=171 I=50 E=6.06365e-12

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

pubmed

156

371

S=738 I=68 E=1.2245e-80

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

pubmed

59

114

S=151 I=50 E=1.81597e-09

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

pubmed

156

371

S=738 I=68 E=1.37147e-80

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

pubmed

61

114

S=141 I=48 E=2.48348e-08

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

pubmed

156

368

S=736 I=69 E=1.99528e-80

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

pubmed

49

114

S=171 I=50 E=5.95884e-12

CysG ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyrin S-adenosyl-L-methionine

Pubmed 18424531

 

prodomImg

sp_Pdown

sp|Q87AI5|CYSG_XYLFT

156

398

S=837 I=68 E=9.28358e-93

Siroheme synthase EC=2.1.1.107 EC=1.3.1.76 EC=4.99.1.4 ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyr

sp_Pdown

sp|Q87AI5|CYSG_XYLFT

28

114

S=168 I=41 E=9.30316e-12

Siroheme synthase EC=2.1.1.107 EC=1.3.1.76 EC=4.99.1.4 ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyr

sp_Pdown

sp|Q9PF46|CYSG_XYLFA

156

398

S=836 I=68 E=1.2487e-92

Siroheme synthase EC=2.1.1.107 EC=1.3.1.76 EC=4.99.1.4 ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyr

sp_Pdown

sp|Q9PF46|CYSG_XYLFA

28

114

S=176 I=43 E=9.55769e-13

Siroheme synthase EC=2.1.1.107 EC=1.3.1.76 EC=4.99.1.4 ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyr

sp_Pdown

sp|Q7VZ77|CYSG_BORPE

156

398

S=752 I=61 E=2.01778e-82

Siroheme synthase EC=2.1.1.107 EC=1.3.1.76 EC=4.99.1.4 ; Cobalamin biosynthesis Lyase Methyltransferase Multifunctional enzyme NAD Oxidoreductase Porphyr

Iprscan IPR016040 [G3DSA:3.40.50.720]

25

139

NAD(P)-binding domain

Iprscan IPR014777 [G3DSA:3.40.1010.10]

142

270

Tetrapyrrole methylase, subdomain 1

Iprscan IPR014776 [G3DSA:3.30.950.10]

271

419

Tetrapyrrole methylase, subdomain 2

Iprscan [PTHR21091:SF16]

203

402

-

Iprscan [PTHR21091]

203

402

-

Iprscan IPR000878 [PF00590]

158

368

Tetrapyrrole methylase

Iprscan IPR006367 [TIGR01470]

28

247

Sirohaem synthase, N-terminal

Iprscan IPR006366 [TIGR01469]

156

392

Uroporphyrin-III C-methyltransferase, C-terminal

Iprscan [seg]

33

48

-

Iprscan [seg]

123

144

-

Iprscan [seg]

267

283

-

Iprscan [seg]

399

423

-

PD001478

156

397

S=431 I=45 E=9.48033e-45

PDA3M5O0

1

32

S=162 I=94 E=3.44334e-12

PD841877

318

396

S=158 I=40 E=1.06033e-11

PD497611

297

393

S=118 I=33 E=8.49108e-07

PD004589

55

122

S=117 I=40 E=1.18263e-06

PDA813E1

335

395

S=104 I=39 E=4.07541e-05

PD780926

305

387

S=104 I=34 E=4.1111e-05

Iprscan IPR000878 [SSF53790]

156

397

Tetrapyrrole methylase

Iprscan IPR016040 [SSF51735]

25

125

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XzJkso77)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

90 hits
swiss-prot

Swiss-Prot ncbi-blastp

141 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr13090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr13090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr13090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr13090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
btuR XFF4834R_chr14390
XFF4834R_chr14380
XFF4834R_chr14380
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14400
XFF4834R_chr14400
ID btuR
AC XFF4834R_chr14390
LT XFF4834R_chr14390
OR XFF4834R_chr from 1649386 to 1649997 on strand +
DE probable cob(I)alamin adenosyltransferase
IP Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase CobA/CobO/ButR
CL 1.5.3.13 Cobalamin (Vitamin B12) GO:0009236
EC
GO InterPro
Biological Process: cobalamin biosynthetic process (GO:0009236)
Molecular Function: ATP binding (GO:0005524)
c-diamide adenosyltransferase activity (GO:0008817)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 22263.3 Da
SQ 203 aa
 
........10........20........30........40........50
| | | | |
MTIPEHDQAHYRERAQRKKELVDRRIARAVIDRGVLLVNTGNGKGKSSSG
FGMLARSLGHGLYCGVVQFIKGTFSTGEEAFFRRFPDLLDYHVMGEGFTW
ETQDRARDIAAAQAAWQLARGMLGDARYDFVLLDELNIALVKDYIALDEV
LAAVAARPPGQHVVITGRGAPAGLIEAADTVTEMRLVKHAFNAGIKAQLG
IEL
Show or not Domain decomposition
 
XFF4834R

YP_365051.1 lcl|cobA-XCV3320

1

203

S=883 I=85 E=3.7688e-100

cob(I)alamin adenosyltransferase

XFF4834R

NP_643499.1 lcl|btuR-XAC3191

1

203

S=875 I=85 E=3.08142e-99

cob(I)alamin adenolsyltransferase

XFF4834R

NP_638411.1 lcl|btuR-XCC3064

1

203

S=860 I=82 E=1.88791e-97

cob(I)alamin adenolsyltransferase

pubmed

7

202

S=419 I=45 E=1.95877e-42

Cob(I)alamin adenosyltransferase EC=2.5.1.17

Pubmed 16088217

 

prodomImg

pubmed

11

202

S=418 I=45 E=2.2916e-42

Cob(I)yrinic acid a,c-diamide adenosyltransferase EC=2.5.1.17 ; ATP-binding Cobalamin biosynthesis Cytoplasm Nucleotide-binding Porphyrin

Pubmed 2644187

 

prodomImg

pubmed

11

202

S=413 I=44 E=1.13987e-41

Cob(I)yrinic acid a,c-diamide adenosyltransferase EC=2.5.1.17 ; ATP-binding Cobalamin biosynthesis Cytoplasm Nucleotide-binding Porphyrin

Pubmed 7916712

 

prodomImg

pubmed

5

203

S=372 I=41 E=1.02236e-36

Cob(I)yrinic acid a,c-diamide adenosyltransferase EC=2.5.1.17 ; ATP-binding Cobalamin biosynthesis Cytoplasm Manganese Nucleotide-binding Porphyri

Pubmed 1655697,1917862

 

prodomImg

pubmed

23

203

S=357 I=44 E=6.04908e-35

Cob(I)alamin adenosyltransferase EC=2.5.1.17

Pubmed 9256491

 

prodomImg

pubmed

18

203

S=215 I=33 E=9.22251e-18

BtuR protein

Pubmed 9742225

 

prodomImg

pubmed

33

167

S=135 I=30 E=5.81198e-08

CobA

Pubmed 12055304

 

prodomImg

pubmed

121

189

S=122 I=35 E=2.20443e-06

Uncharacterized protein all2391

Pubmed 7883709

 

prodomImg

sp_Pdown

sp|Q9I472|COBO_PSEAE

4

203

S=591 I=60 E=2.23032e-63

Cob(I)yrinic acid a,c-diamide adenosyltransferase EC=2.5.1.17 ; ATP-binding Cobalamin biosynthesis Cytoplasm Manganese Nucleotide-binding Porphyrin

sp_Pdown

sp|P0A9H5|BTUR_ECOLI

11

202

S=418 I=45 E=1.58727e-42

Cob(I)yrinic acid a,c-diamide adenosyltransferase EC=2.5.1.17 ; ATP-binding Cobalamin biosynthesis Cytoplasm Nucleotide-binding Porphyrin

sp_Pdown

sp|P0A9H6|BTUR_ECOL6

11

202

S=418 I=45 E=1.58727e-42

Cob(I)yrinic acid a,c-diamide adenosyltransferase EC=2.5.1.17 ; ATP-binding Cobalamin biosynthesis Cytoplasm Nucleotide-binding Porphyrin

sp_Pdown

sp|P31570|BTUR_SALTY

11

202

S=413 I=44 E=7.89528e-42

Cob(I)yrinic acid a,c-diamide adenosyltransferase EC=2.5.1.17 ; ATP-binding Cobalamin biosynthesis Cytoplasm Nucleotide-binding Porphyrin

sp_Pdown

sp|P29930|COBO_PSEDE

5

203

S=372 I=41 E=7.08135e-37

Cob(I)yrinic acid a,c-diamide adenosyltransferase EC=2.5.1.17 ; ATP-binding Cobalamin biosynthesis Cytoplasm Manganese Nucleotide-binding Porphyri

Iprscan [G3DSA:3.40.50.300]

32

203

-

Iprscan IPR003724 [PIRSF015617]

1

203

Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase CobA/CobO/ButR

Iprscan IPR003724 [PF02572]

32

202

Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase CobA/CobO/ButR

Iprscan [PF12557]

3

26

-

Iprscan IPR003724 [TIGR00708]

29

203

Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase CobA/CobO/ButR

Iprscan [seg]

43

50

-

Iprscan [seg]

103

120

-

PD009609

77

203

S=268 I=47 E=5.46085e-25

PDA1T388

1

36

S=172 I=92 E=2.12693e-13

Iprscan [SSF52540]

12

203

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9WFG9LVG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

6 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14390.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14390.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14390.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14390.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cobD XFF4834R_chr14400
XFF4834R_chr14390
XFF4834R_chr14390
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4648
XFF4834R_chr_4648
ID cobD
AC XFF4834R_chr14400
LT XFF4834R_chr14400
OR XFF4834R_chr from 1650068 to 1650982 on strand +
DE putative cobalamin biosynthesis protein
IP Cobalamin (vitamin B12) biosynthesis CbiB
CL 1.5.3.13 Cobalamin (Vitamin B12) GO:0009236
EC
GO InterPro
Biological Process: cobalamin biosynthetic process (GO:0009236)
Cellular Component: integral to membrane (GO:0016021)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 32129 Da
SQ 304 aa
 
........10........20........30........40........50
| | | | |
MLLVIATAAVLLDLLLGEPRRGHPLVLFGNWAQRVEARLHRDRRSAGILA
WCVSVLPLTCVAAVVQWGLWCVSPWAAAGFVAITLYLALGLRSLGEHAQA
VIDALQVTDLPAARAAVGRIVSRDTAALDATQVAAAATESVLENGSDAVF
AALFWGVVLGAPGAVLYRLSNTLDAMWGYRTPRYVNFGWAAARIDDALNW
LPARLTAATYAVLGRTRAGLRCAWRQGRGWKSPNAGPVMAAGAGALHVQL
GGPAPYHGHWQARPALGEGAAASANSVQRGLRLVRAGVAFWLLLGVLATA
LAMR
XFF4834R

NP_643498.1 lcl|cobD-XAC3190

1

304

S=1404 I=92 E=4.5481e-163

cobalamin biosynthesis protein

XFF4834R

YP_365050.1 lcl|cobD-XCV3319

1

304

S=1350 I=90 E=1.35754e-156

cobalamin biosynthesis protein

XFF4834R

NP_638409.1 lcl|cobD-XCC3062

1

288

S=1026 I=79 E=2.93067e-117

cobalamin biosynthesis protein

pubmed

9

299

S=379 I=39 E=2.35093e-37

Cobalamin biosynthesis protein cobD ; Cell membrane Transmembrane

Pubmed 7635831,9256491

 

prodomImg

pubmed

8

285

S=337 I=36 E=3.65206e-32

CbiB

Pubmed 12055304

 

prodomImg

pubmed

2

268

S=326 I=31 E=7.5241e-31

Cobalamin biosynthesis protein

Pubmed 17121823

 

prodomImg

pubmed

2

269

S=318 I=30 E=5.63816e-30

Cobalamin biosynthesis protein

Pubmed 18245259,18762399

 

prodomImg

pubmed

11

281

S=299 I=34 E=1.45593e-27

Cobalamin biosynthesis protein cobD ; Cell membrane Porphyrin Transmembrane

Pubmed 2211520

 

prodomImg

pubmed

1

284

S=284 I=33 E=9.07704e-26

Cobalamin biosynthesis protein cbiB ; Cell membrane Transmembrane

Pubmed 8501034

 

prodomImg

pubmed

2

282

S=280 I=33 E=2.89434e-25

Cobalamin biosynthesis protein

Pubmed 16088217

 

prodomImg

pubmed

92

295

S=270 I=41 E=4.35665e-24

CobD protein

Pubmed 10200311

 

prodomImg

sp_Pdown

sp|A4VJ38|COBD_PSEU5

18

294

S=674 I=59 E=3.38178e-73

Cobalamin biosynthesis protein cobD ; Cell membrane Transmembrane

sp_Pdown

sp|Q9I469|COBD_PSEAE

1

285

S=631 I=54 E=4.6905e-68

Cobalamin biosynthesis protein cobD ; Cell membrane Porphyrin Transmembrane

sp_Pdown

sp|Q7NXQ1|COBD_CHRVO

9

288

S=607 I=53 E=4.36354e-65

Cobalamin biosynthesis protein cobD ; Cell membrane Transmembrane

sp_Pdown

sp|Q8KDV4|COBD_CHLTE

4

297

S=403 I=39 E=2.12741e-40

Cobalamin biosynthesis protein cobD ; Cell membrane Transmembrane

sp_Pdown

sp|Q10518|COBD_MYCTU

11

294

S=390 I=39 E=8.35546e-39

Cobalamin biosynthesis protein cobD ; Cell membrane Transmembrane

Iprscan IPR004485 [PF03186]

4

286

Cobalamin (vitamin B12) biosynthesis CbiB

Iprscan IPR004485 [TIGR00380]

1

294

Cobalamin (vitamin B12) biosynthesis CbiB

Iprscan [seg]

125

138

-

Iprscan [SignalP-NN(euk)]

1

17

-

PD581445

173

284

S=215 I=48 E=1.31695e-18

PD006983

85

172

S=171 I=47 E=3.27597e-13

PDA1X645

48

75

S=112 I=82 E=4.57588e-06

PDA2N5H9

257

288

S=105 I=75 E=3.3404e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one H4gKok6y)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

52 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cobQ XFF4834R_chr14420
XFF4834R_chr_4649
XFF4834R_chr_4649
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14430
XFF4834R_chr14430
ID cobQ
AC XFF4834R_chr14420
LT XFF4834R_chr14420
OR XFF4834R_chr from 1652055 to 1653530 on strand +
DE putative cobyric acid synthase
IP Cobyric acid synthase CobQ; CobB/CobQ-like glutamine amidotransferase
CL 1.5.3.13 Cobalamin (Vitamin B12) GO:0009236
EC
GO InterPro
Biological Process: cobalamin biosynthetic process (GO:0009236)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100331)
MW 51847.9 Da
SQ 491 aa
 
........10........20........30........40........50
| | | | |
MSARVLMVQGCTSDAGKSTLVAALCRWLHRQGIAVAPFKPQNMALNSAVT
VDGGEIGRAQALQAQACGLEPQTDFNPVLLKPNSDTGAQVIVHGQPVATL
DAVGYHAFKATAFKAVLASHERLVERFDVVLVEGAGSPAEINLRANDIAN
MGYAEAVDCAVILVADIDRGGVFAHLVGTLALLSASERARVAGVVINRFR
GDLALLQPGLEWLERETGKPVLGVLPYLHGLQLDAEDAVPRNAPQKPQAQ
LRVVVPVLPRISNHTDIDALLAHPQVDVRLIGPGQTPPPCDLILLPGSKS
TRCDLQWLRTHGWDAAIARHLRYGGKLLGICGGLQMLGTHLHDPDGIEGA
AGSSPGLGWLPLQTTLQPHKQLHRVHGRLLLGDAGVSGYEIHCGISSGAA
LARPLLRLDDGRTDGAISDDGQVLGTYVHGVFDHPQALAALLAWAGLAQA
APLDLAALREASLERLADTVHTHLDTAALTRLVSREAACST
XFF4834R

NP_643496.1 lcl|cobQ-XAC3188

1

491

S=2238 I=89 E=0

cobyric acid synthase

XFF4834R

YP_365048.1 lcl|cobQ-XCV3317

1

435

S=2079 I=93 E=0

cobyric acid synthase

XFF4834R

NP_638408.2 lcl|XCC3061

1

491

S=1949 I=78 E=0

cobyric acid synthase

pubmed

6

432

S=1022 I=51 E=5.40448e-115

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 7635831,9256491

 

prodomImg

pubmed

1

434

S=984 I=49 E=2.27026e-110

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 17965706

 

prodomImg

pubmed

1

435

S=960 I=45 E=1.72825e-107

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 18245259,18762399

 

prodomImg

pubmed

4

432

S=951 I=47 E=2.16617e-106

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 1655697,1917839

 

prodomImg

pubmed

1

435

S=949 I=44 E=4.42778e-106

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 17121823

 

prodomImg

pubmed

4

433

S=944 I=47 E=1.62321e-105

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 8501034

 

prodomImg

pubmed

4

434

S=930 I=50 E=8.65012e-104

Putative cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 16088217

 

prodomImg

pubmed

3

434

S=921 I=45 E=1.0842e-102

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 12446909

 

prodomImg

pubmed

6

432

S=902 I=45 E=2.23184e-100

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 19014707

 

prodomImg

pubmed

4

434

S=848 I=42 E=8.21226e-94

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Pubmed 18812508

 

prodomImg

sp_Pdown

sp|Q8PHR1|COBQ_XANAC

1

491

S=2238 I=89 E=0

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

sp_Pdown

sp|Q3BQB5|COBQ_XANC5

1

435

S=2079 I=93 E=0

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

sp_Pdown

sp|B0RPU7|COBQ_XANCB

1

491

S=1936 I=78 E=0

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

sp_Pdown

sp|Q2SNC4|COBQ_HAHCH

1

436

S=1577 I=68 E=0

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

sp_Pdown

sp|A6V8T2|COBQ_PSEA7

4

433

S=1541 I=70 E=6.05983e-178

Cobyric acid synthase ; Cobalamin biosynthesis Glutamine amidotransferase

Iprscan [G3DSA:3.40.50.300]

3

246

-

Iprscan [G3DSA:3.40.50.880]

250

451

-

Iprscan [PTHR21343]

5

264

-

Iprscan IPR011698 [PF07685]

285

435

CobB/CobQ-like glutamine amidotransferase

Iprscan [PF01656]

6

230

-

Iprscan IPR004459 [TIGR00313]

6

479

Cobyric acid synthase CobQ

Iprscan [seg]

398

412

-

Iprscan [seg]

437

468

-

PDA122T1

51

239

S=623 I=68 E=6.18736e-68

PDA169K3

258

352

S=199 I=46 E=1.43036e-16

PD686462

6

50

S=150 I=64 E=1.38647e-10

PDA3B9B8

232

258

S=125 I=93 E=1.25652e-07

PD183660

356

434

S=120 I=37 E=6.5286e-07

Iprscan [SSF52540]

1

246

-

Iprscan [SSF52317]

248

429

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rG4RUuRN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

260 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cobU XFF4834R_chr14430
XFF4834R_chr14420
XFF4834R_chr14420
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14440
XFF4834R_chr14440
ID cobU
AC XFF4834R_chr14430
LT XFF4834R_chr14430
OR XFF4834R_chr from 1653518 to 1654039 on strand +
DE probable bifunctional cobinamide kinase/ cobinamide phosphate guanylyltransferase
IP Cobinamide kinase/cobinamide phosphate guanyltransferase
CL 1.5.3.13 Cobalamin (Vitamin B12) GO:0009236
EC
GO InterPro
Biological Process: cofactor biosynthetic process (GO:0051188)
Molecular Function: adenosylcobinamide kinase activity (GO:0043752)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: adenosylcobinamide-phosphate guanylyltransferase activity (GO:0043753)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 18813.6 Da
SQ 173 aa
 
........10........20........30........40........50
| | | | |
MQHLILGGARSGKSALAERIAAASGRAVTYLATAQAFDEEMHRRIAHHRS
QRPAHWQCVEEPIALAASLQAHAAPDRCVLVDCLTLWLSNLLGHPDADVF
ARERDALLATLPQLPGQILLVSNEVGQGIVPMGELTRRFVDEAGWLHQAL
ALQCERVVLVVAGLPMVLKGERV
Show or not Domain decomposition
 
XFF4834R

NP_643495.1 lcl|cobU-XAC3187

1

173

S=829 I=93 E=1.06565e-93

adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase

XFF4834R

YP_365047.1 lcl|cobU-XCV3316

1

169

S=773 I=89 E=5.55744e-87

adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase

XFF4834R

NP_638407.1 lcl|cobU-XCC3060

1

173

S=712 I=81 E=1.51905e-79

adenosylcobinamide kinase/adenosylcobinamide- phosphate guanylyltransferase

pubmed

1

171

S=450 I=60 E=2.34786e-46

Putative cobinamide kinase

Pubmed 14973122

 

prodomImg

pubmed

4

170

S=370 I=47 E=1.15911e-36

Bifunctional adenosylcobalamin biosynthesis protein cobP EC=2.7.1.156 EC=2.7.7.62 ; ATP-binding GTP-binding Kinase Multifunctional enzyme Nucleoti

Pubmed 1655697,1655696

 

prodomImg

pubmed

1

169

S=325 I=45 E=3.98104e-31

Cobinamide kinase and guanylyltransferase ; Nucleotidyltransferase

Pubmed 16088217

 

prodomImg

pubmed

4

169

S=315 I=45 E=5.94036e-30

CobP protein Cobinamide kinase / Cobinamide phosphate guanylyltransferase ; Nucleotidyltransferase

Pubmed 7635831,9256491

 

prodomImg

pubmed

1

169

S=276 I=40 E=2.86893e-25

Putative cobinamide kinase/cobinamide phosphate guanylyltransferase ; Nucleotidyltransferase

Pubmed 17049458

 

prodomImg

pubmed

1

169

S=276 I=40 E=3.56765e-25

Bifunctional adenosylcobalamin biosynthesis protein cobU EC=2.7.1.156 EC=2.7.7.62 ; ATP-binding GTP-binding Kinase Multifunctional enzyme Nucleoti

Pubmed 7592411

 

prodomImg

pubmed

4

170

S=275 I=40 E=4.47539e-25

Cobinamide kinase EC=2.7.1.- ; ATP-binding Nucleotide-binding Transferase

Pubmed 12446909

 

prodomImg

pubmed

1

169

S=273 I=40 E=7.95684e-25

CobU

Pubmed 16547059

 

prodomImg

pubmed

1

169

S=268 I=40 E=2.79253e-24

Bifunctional adenosylcobalamin biosynthesis protein cobU EC=2.7.1.156 EC=2.7.7.62 ; ATP-binding GTP-binding Kinase Multifunctional enzyme Nucleot

Pubmed 8501034

 

prodomImg

sp_Pdown

sp|Q9I466|COBP_PSEAE

1

171

S=499 I=64 E=2.05874e-52

Bifunctional adenosylcobalamin biosynthesis protein cobP EC=2.7.1.156 EC=2.7.7.62 ; ATP-binding GTP-binding Kinase Multifunctional enzyme Nucleotide-bind

sp_Pdown

sp|P29931|COBP_PSEDE

4

170

S=370 I=47 E=8.06173e-37

Bifunctional adenosylcobalamin biosynthesis protein cobP EC=2.7.1.156 EC=2.7.7.62 ; ATP-binding GTP-binding Kinase Multifunctional enzyme Nucleoti

sp_Pdown

sp|P0AE76|COBU_ECOLI

1

169

S=276 I=40 E=2.48133e-25

Bifunctional adenosylcobalamin biosynthesis protein cobU EC=2.7.1.156 EC=2.7.7.62 ; ATP-binding GTP-binding Kinase Multifunctional enzyme Nucleoti

sp_Pdown

sp|P0AE77|COBU_ECO57

1

169

S=276 I=40 E=2.48133e-25

Bifunctional adenosylcobalamin biosynthesis protein cobU EC=2.7.1.156 EC=2.7.7.62 ; ATP-binding GTP-binding Kinase Multifunctional enzyme Nucleo

sp_Pdown

sp|Q05599|COBU_SALTY

1

169

S=268 I=40 E=1.94222e-24

Bifunctional adenosylcobalamin biosynthesis protein cobU EC=2.7.1.156 EC=2.7.7.62 ; ATP-binding GTP-binding Kinase Multifunctional enzyme Nucleot

Iprscan [G3DSA:3.40.50.300]

2

169

-

Iprscan IPR003203 [PIRSF006135]

1

171

Cobinamide kinase/cobinamide phosphate guanyltransferase

Iprscan IPR003203 [PF02283]

4

167

Cobinamide kinase/cobinamide phosphate guanyltransferase

Iprscan [seg]

64

74

-

PD011091

30

169

S=317 I=51 E=6.40134e-31

PDA5A439

4

94

S=150 I=34 E=9.8204e-11

PDA1G2R9

30

63

S=140 I=71 E=1.55758e-09

PDA265N9

1

29

S=135 I=100 E=6.01672e-09

PDA5A441

1

52

S=123 I=55 E=1.80342e-07

PDA2Q7W7

1

25

S=103 I=88 E=4.73885e-05

Iprscan [SSF52540]

2

169

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hxz6Sb5C)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14430.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14430.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cobT XFF4834R_chr14440
XFF4834R_chr14430
XFF4834R_chr14430
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14450
XFF4834R_chr14450
ID cobT
AC XFF4834R_chr14440
LT XFF4834R_chr14440
OR XFF4834R_chr from 1654036 to 1655082 on strand +
DE probable nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
IP Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase-like, core; Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase, core, prokaryotic
CL 1.5.3.13 Cobalamin (Vitamin B12) GO:0009236
EC
GO InterPro
Biological Process: nucleoside biosynthetic process (GO:0009163)
Biological Process: cobalamin biosynthetic process (GO:0009236)
Molecular Function: nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase activity (GO:0008939)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100331)
MW 35909.7 Da
SQ 348 aa
 
........10........20........30........40........50
| | | | |
MTSDWIFGACAVPDPRMRSAALAQQEQLTKPPGALGRLEHLAVQLAAWQR
TERPGAQRVWIAVYAADHGVAAEGVSAFPQAVTGEMVRNFARGGAAIAVL
ARELGARLEVVNLGVVNDPGDLPRVRRAWIAPSSANICEQPAMTATQLRD
ALAAGADSIAQARSCDTQLFVGGEMGIGNTTSAAALGCALLSQFPQAMAG
AGTGLDAEGIAHKATVITRALALHADASSPLERLRCLGGFEIAALVGAYI
AAAQAGIPVLVDGFITTAAALVATRLNPGVREWLLFGHRSQERGHAALLR
ALDAEPLLQLDLRLGEASGAAVAIPLLRSACALHNGMATFAEAGVSDA
Show or not Domain decomposition
 
XFF4834R

NP_643494.1 lcl|cobT-XAC3186

1

348

S=1619 I=95 E=0

nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

XFF4834R

YP_365046.1 lcl|cobT-XCV3315

1

348

S=1602 I=93 E=0

nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

XFF4834R

NP_638406.1 lcl|cobT-XCC3059

1

348

S=1452 I=85 E=7.66696e-169

nicotinate-nucleotide--dimethylbenzimidazolephosphoribosyltransferase

pubmed

38

347

S=822 I=56 E=6.25117e-91

Nicotinate nucleotide diethylbenzimidazole phosphoribosyltransferase ; Cobalamin biosynthesis Glycosyltransferase

Pubmed 12904565

 

prodomImg

pubmed

13

346

S=528 I=36 E=2.81639e-55

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

Pubmed 18524787

 

prodomImg

pubmed

20

347

S=511 I=44 E=2.96269e-53

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase Plasmid

Pubmed 10200311

 

prodomImg

pubmed

13

345

S=511 I=39 E=2.98863e-53

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

Pubmed 16088217

 

prodomImg

pubmed

24

346

S=500 I=41 E=5.99833e-52

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

Pubmed 9256491,7635831

 

prodomImg

pubmed

13

347

S=499 I=40 E=1.01209e-51

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

Pubmed 1917841

 

prodomImg

pubmed

1

345

S=487 I=35 E=2.46083e-50

CobT ; Cobalamin biosynthesis Glycosyltransferase

Pubmed 16547059

 

prodomImg

pubmed

14

345

S=468 I=35 E=5.02169e-48

Putative dimethylbenzimidazol phosphoribosyltransferase ; Cobalamin biosynthesis Glycosyltransferase

Pubmed 17049458

 

prodomImg

pubmed

15

345

S=458 I=34 E=8.6149e-47

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

Pubmed 7592411

 

prodomImg

pubmed

12

345

S=454 I=35 E=2.7953e-46

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Disulfide bond Glycosyltransferase

Pubmed 7883701

 

prodomImg

sp_Pdown

sp|Q8PHR3|COBT_XANAC

1

348

S=1619 I=95 E=0

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

sp_Pdown

sp|Q3BQB7|COBT_XANC5

1

348

S=1602 I=93 E=0

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

sp_Pdown

sp|B2SJ67|COBT_XANOP

1

348

S=1556 I=91 E=4.71724e-180

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

sp_Pdown

sp|Q2P631|COBT_XANOM

1

348

S=1549 I=91 E=3.59702e-179

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

sp_Pdown

sp|Q8P6B1|COBT_XANCP

1

348

S=1452 I=85 E=2.003e-167

Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase EC=2.4.2.21 ; Cobalamin biosynthesis Glycosyltransferase

Iprscan [G3DSA:1.10.1610.10]

1

49

-

Iprscan [G3DSA:3.40.50.10210]

56

328

-

Iprscan [PTHR21712:SF4]

19

348

-

Iprscan [PTHR21712]

19

348

-

Iprscan IPR003200 [PF02277]

9

345

Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase-like, core

Iprscan IPR017846 [TIGR03160]

13

345

Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase, core, prokaryotic

Iprscan [seg]

243

255

-

PD009438

13

347

S=728 I=53 E=9.5439e-81

Iprscan IPR003200 [SSF52733]

3

348

Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase-like, core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eSkgNikO)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

14 hits
swiss-prot

Swiss-Prot ncbi-blastp

179 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14440.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14440.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBliSNFb/XFF4834R_chr14440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cobC XFF4834R_chr14450
XFF4834R_chr14440
XFF4834R_chr14440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14460
XFF4834R_chr14460
ID cobC
AC XFF4834R_chr14450
LT XFF4834R_chr14450
OR XFF4834R_chr from 1655079 to 1655693 on strand +
DE putative alpha-ribazole-5'-phosphate phosphatase
IP Histidine phosphatase superfamily, clade-1
CL 1.5.3.13 Cobalamin (Vitamin B12) GO:0009236
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110119)
MW 22186.9 Da
SQ 204 aa
 
........10........20........30........40........50
| | | | |
MSAQITLLRHGDTGQRSYRGQLDDPLTELGWQQLRAATADGVWDAVVAST
LQRCALFATELAQARAIPLQLEPRLREYHFGRWQGVPVADIDRDEGQALG
RFWADPVRHPPPQAEPFTDFCERLSAALDAIVVRYPAQRVLVVTHGGAIR
ALQCLVAGSGFCRMTELAVPHASLHALAWPPTDAAGGLRSPVSSTALPPA
HDTE
XFF4834R

XFF4834R_chr10320 lcl|cobC-XFF4834R_chr10320

4

164

S=103 I=29 E=3.10825e-06

predicted alpha-ribazole-5'-P phosphatase

XFF4834R

NP_643493.1 lcl|XAC3185-XAC3185

1

204

S=971 I=92 E=8.25579e-111

hypothetical protein

XFF4834R

YP_365045.1 lcl|XCV3314

1

195

S=852 I=86 E=1.71212e-96

putative alpha-ribazole-5'-phosphate phosphatase

XFF4834R

NP_638405.1 lcl|XCC3058

1

185

S=793 I=82 E=2.7495e-89

hypothetical protein

XFF4834R

lcl|XALc_0563

4

183

S=112 I=30 E=9.24975e-07

putative phosphoglycerate mutase protein

XFF4834R

NP_641375.1 lcl|pgmA-XAC1028

4

164

S=107 I=30 E=3.89855e-06

phosphoglycerate mutase

XFF4834R

NP_636334.1 lcl|pgmA-XCC0948

4

164

S=103 I=31 E=9.82365e-06

phosphoglycerate mutase

XFF4834R

YP_362788.1 lcl|XCV1057

4

164

S=102 I=29 E=1.34458e-05

putative phosphoglycerate mutase

pubmed

1

178

S=381 I=46 E=9.50773e-38

Alpha-ribazole-5'-phosphate phosphatase

Pubmed 12904565

 

prodomImg

pubmed

1

174

S=192 I=28 E=7.18026e-15

Putative uncharacterized protein

Pubmed 19706155

 

prodomImg

pubmed

9

152

S=181 I=34 E=1.44111e-13

Phosphoglycerate mutase

Pubmed 11514674,11827481

 

prodomImg

pubmed

1

158

S=148 I=28 E=1.47437e-09

Uncharacterized phosphatase phoE EC=3.1.3.- ; Hydrolase

Pubmed 10869096

 

prodomImg

pubmed

7

175

S=148 I=28 E=1.51344e-09

Phosphoglycerate mutase

Pubmed 17121823

 

prodomImg

sp_Pdown

sp|P64956|Y2253_MYCBO

4

189

S=153 I=35 E=2.29131e-10

Uncharacterized protein Mb2253c

sp_Pdown

sp|P64955|Y2228_MYCTU

4

189

S=153 I=35 E=2.29131e-10

Uncharacterized protein Rv2228c/MT2287

sp_Pdown

sp|O07617|PHOE_BACSU

1

158

S=148 I=28 E=1.00876e-09

Uncharacterized phosphatase phoE EC=3.1.3.- ; Hydrolase

sp_Pdown

sp|B1JL20|GPMB_YERPY

4

158

S=148 I=29 E=1.00876e-09

Probable phosphoglycerate mutase gpmB EC=5.4.2.1 ; Glycolysis Isomerase

sp_Pdown

sp|Q66EU3|GPMB_YERPS

4

158

S=148 I=29 E=1.00876e-09

Probable phosphoglycerate mutase gpmB EC=5.4.2.1 ; Glycolysis Isomerase

Iprscan [G3DSA:3.40.50.1240]

4

177

-

Iprscan [PTHR23029]

3

158

-

Iprscan IPR013078 [PF00300]

4

152

Histidine phosphatase superfamily, clade-1

Iprscan IPR013078 [SM00855]

4

152

Histidine phosphatase superfamily, clade-1

PD741104

72

151

S=133 I=34 E=1.09083e-08

PD155341

47

129

S=132 I=41 E=1.48008e-08

PD698575

153

184

S=110 I=69 E=6.33733e-06

PD291384

4

62

S=102 I=44 E=6.49985e-05

Iprscan [SSF53254]

1

184

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one J6SB4AAw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

76 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits