Xanthomonas fuscans subsp. fuscans

8 hits

  1. XFF4834R_chr02150ubiBXFF4834R_chr02150probable ubiquinone biosynthesis protein UbiB
  2. XFF4834R_chr04850XFF4834R_chr04980955_0551776_r3_XFF4834R-XFF4834R_chr04850XFF4834R_chr04850hypothetical ubiquinone biosynthesis protein
  3. XFF4834R_chr06520ubiEXFF4834R_chr06520Ubiquinone/menaquinone biosynthesis methyltransferase
  4. XFF4834R_chr08750XFF4834R_chr08750XFF4834R_chr08750putative 2-octaprenyl-6-methoxyphenol hydroxylase, FAD/NAD(P)-binding
  5. XFF4834R_chr08760XFF4834R_chr08760XFF4834R_chr08760putative 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
  6. XFF4834R_chr16060XFF4834R_chr17280121_1854690_r1_XFF4834R-XFF4834R_chr16060XFF4834R_chr16060putative secreted lipid/polyisoprenoid-binding, YceI like protein
  7. XFF4834R_chr16080XFF4834R_chr17290260_1855922_r2_XFF4834R-XFF4834R_chr16080XFF4834R_chr16080putative secreted Lipid/polyisoprenoid/binding, YceI like protein.
  8. XFF4834R_chr23880ubiGXFF4834R_chr23880probable 3-demethylubiquinone-9 3-methyltransferase

ubiB XFF4834R_chr02150
XFF4834R_chr02140
XFF4834R_chr02140
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02160
XFF4834R_chr02160
ID ubiB
AC XFF4834R_chr02150
LT XFF4834R_chr02150
OR XFF4834R_chr from 252333 to 254006 on strand +
DE probable ubiquinone biosynthesis protein UbiB
IP ABC-1
CL 1.5.3.11 Menaquinone (MK), ubiquinone (Q) GO:0009234 GO:0006744
EC
GO InterPro
Biological Process: ubiquinone biosynthetic process (GO:0006744)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100419)
MW 62576.8 Da
SQ 557 aa
 
........10........20........30........40........50
| | | | |
MKAILRASRIGRVILRYRLDALLEGTPAERWLRLAKPFVPRASAEIAAQS
RGARLRLALQELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDG
QAARLIVEAALGLPVSVAFASFDTVPLASASIAQVHAATLPPDANGVRRE
VVVKVLRPEIERQIDADIALLHSLATLVERTHPRADKIRPREVVAEIEGT
LAAELDLQREGANASVLRRFWEGSDDLYVPEVIWSHTAERALTLERVYGI
PSDDIAKLDAAGIDRKALAAKGVRVFYTQVFRDNFFHADAHAGNIWVDSD
PERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDYRRMAELHVEA
GWMPSNVRIDELEAAARSVCEPYFTRPLSEISLAQVLIKLFRVAQRYELT
LQPQLILLQKTLLNIEGVGRQLDPRLDIWAVARPVLERILRERYSPRRVL
RELGKRLPEIMTHAPDMPRLVHSWLKQQVEGRHQIGIRSPELLALDLSLR
KLQTRVVTAITGSGLLVVAAVLYGLHPDGWYLGTVPVWSWISGGAGSAAL
LVAWLRR
XFF4834R

XFF4834R_chr27730 lcl|XFF4834R_chr30320750_3203426_r2_XFF4834R-XFF4834R_chr27730

50

511

S=627 I=36 E=3.47889e-69

XFF4834R

XFF4834R_chr04140 lcl|XFF4834R_chr04250170_0469062_r1_XFF4834R-XFF4834R_chr04140

6

510

S=422 I=29 E=2.4892e-44

XFF4834R

YP_361979.1 lcl|ubiB-XCV0248

1

536

S=2705 I=98 E=0

putative ubiquinone biosynthesis protein UbiB

XFF4834R

NP_640598.1 lcl|ubiB-XAC0242

1

536

S=2690 I=98 E=0

putative ubiquinone biosynthesis protein UbiB

XFF4834R

NP_635619.1 lcl|ubiB-XCC0224

1

536

S=2636 I=95 E=0

putative ubiquinone biosynthesis protein UbiB

XFF4834R

lcl|ubiB-XALc_3066

1

533

S=2201 I=83 E=0

probable ubiquinone biosynthesis ubib. transmembrane protein

XFF4834R

YP_363502.1 lcl|XCV1771

50

511

S=628 I=35 E=1.06748e-68

hypothetical protein

XFF4834R

NP_642069.1 lcl|aarF-XAC1738

50

511

S=624 I=35 E=2.80971e-68

ubiquinone biosynthesis protein

XFF4834R

NP_637090.1 lcl|aarF-XCC1720

50

511

S=611 I=35 E=1.26871e-66

ubiquinone biosynthesis protein

XFF4834R

YP_362179.1 lcl|XCV0448

6

510

S=422 I=29 E=7.90904e-44

hypothetical protein

XFF4834R

NP_640777.1 lcl|XAC0422-XAC0422

6

510

S=421 I=29 E=1.19149e-43

ABC transporter substrate binding protein

XFF4834R

NP_635798.1 lcl|XCC0404

6

510

S=409 I=30 E=3.41896e-42

ABC transporter substrate binding protein

pubmed

6

513

S=1137 I=47 E=9.14852e-129

Probable ubiquinone biosynthesis protein ubiB ; Cell inner membrane Transmembrane

Pubmed 1379743

 

prodomImg

pubmed

4

478

S=1110 I=48 E=1.55324e-125

Probable ubiquinone biosynthesis protein ubiB ; Cell inner membrane Transmembrane

Pubmed 9422602,10960098

 

prodomImg

pubmed

112

477

S=913 I=49 E=1.03736e-101

Ubiquinone biosynthesis I ; Cell inner membrane Transmembrane

Pubmed 18075090

 

prodomImg

pubmed

53

451

S=534 I=35 E=9.55683e-56

2-octaprenylphenol hydroxylase of ubiquinone biosynthetic pathway

Pubmed 15608629

 

prodomImg

pubmed

49

482

S=427 I=31 E=7.60215e-43

Abc1

Pubmed 12647947

 

prodomImg

pubmed

54

442

S=421 I=32 E=4.46269e-42

DynR3

Pubmed 18328078

 

prodomImg

pubmed

62

440

S=412 I=32 E=5.17136e-41

CalR3

Pubmed 12183629

 

prodomImg

pubmed

55

351

S=337 I=29 E=6.43858e-32

Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic EC=2.7.-.- ; ATP-binding Nucleotide-binding Plastid Transferase Transi

Pubmed 10470850

 

prodomImg

pubmed

31

452

S=331 I=28 E=4.05268e-31

Uncharacterized protein At4g31390.2

Pubmed 16461379

 

prodomImg

pubmed

53

323

S=324 I=29 E=2.35839e-30

Probable serine/threonine-protein kinase abkB EC=2.7.11.- ; ATP-binding Coiled Nucleotide-binding Transferase

Pubmed 16596165

 

prodomImg

Iprscan IPR004147 [PF03109]

109

233

ABC-1

Iprscan IPR010232 [TIGR01982]

4

450

2-polyprenylphenol 6-hydroxylase

Iprscan [seg]

515

522

-

Iprscan [seg]

537

555

-

Iprscan [tmhmm]

506

523

-

Iprscan [tmhmm]

533

555

-

PD602985

315

419

S=284 I=47 E=7.15681e-27

PDA1F3J6

1

58

S=259 I=91 E=7.85748e-24

PD297943

473

536

S=201 I=59 E=7.28538e-17

PD038496

227

314

S=200 I=41 E=1.19752e-16

PDA0A871

54

325

S=163 I=25 E=3.51851e-12

PDA9U2J1

64

418

S=149 I=27 E=1.41853e-10

PD342041

59

127

S=143 I=48 E=8.18323e-10

PD253276

419

472

S=133 I=46 E=1.60001e-08

PD713950

170

224

S=111 I=47 E=7.0324e-06

PDA7F1G0

100

140

S=104 I=49 E=4.16438e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vGDw0NBK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

36 hits
swiss-prot

Swiss-Prot ncbi-blastp

185 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr02150.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr02150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr02150.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr02150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr04980955_0551776_r3_XFF4834R-XFF4834R_chr04850 XFF4834R_chr04850
XFF4834R_chr04840
XFF4834R_chr04840
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04860
XFF4834R_chr04860
ID XFF4834R_chr04980955_0551776_r3_XFF4834R-XFF4834R_chr04850
AC XFF4834R_chr04850
LT XFF4834R_chr04850
OR XFF4834R_chr from 550955 to 551608 on strand -
DE hypothetical ubiquinone biosynthesis protein
IP Ubiquinone biosynthesis-like protein
CL 1.5.3.11 Menaquinone (MK), ubiquinone (Q) GO:0009234 GO:0006744
EC
GO InterPro
Biological Process: protein metabolic process (GO:0019538)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: ubiquinone biosynthetic process (GO:0006744)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: transition metal ion binding (GO:0046914)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100329)
MW 23977.8 Da
SQ 217 aa
 
........10........20........30........40........50
| | | | |
MTQISPTRLHSPLDRLLVEAQRALDTVFGNPPAERPNPAADTPDVVLDPE
QRRHAAGLMRINHVGEVCAQGLYFGQAAVARDAHTQHHLLEAAQEETDHL
AWCADRLHELDSRPSLFNPVWYAGSYALGALAGLRGDDWSLGFVVETERQ
VEAHLDEHLETLPQSDQRSRAILRVMKIDEARHADQAEQAGARPLPAPIP
SAMALASKLMKTVAYRL
pubmed

13

217

S=491 I=48 E=4.09573e-51

2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase EC=1.14.13.- ; Cell membrane Iron Metal-binding Monooxygenase Oxidoreductase Ubiquinone biosyn

Pubmed 17853511

 

prodomImg

pubmed

4

217

S=479 I=49 E=1.3512e-49

2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase EC=1.14.13.- ; Cell membrane Iron Metal-binding Monooxygenase Oxidoreductase Ubiquinon

Pubmed 11435415

 

prodomImg

pubmed

58

196

S=122 I=23 E=2.25774e-06

Ubiquinone biosynthesis protein

Pubmed 18495616

 

prodomImg

pubmed

58

196

S=122 I=23 E=2.39983e-06

Ubiquinone biosynthesis protein

Pubmed 18495616

 

prodomImg

pubmed

58

196

S=121 I=23 E=2.50676e-06

Ubiquinone biosynthesis protein

Pubmed 18495616

 

prodomImg

pubmed

58

196

S=121 I=23 E=2.50676e-06

Ubiquinone biosynthesis protein

Pubmed 18495616

 

prodomImg

pubmed

58

196

S=121 I=23 E=2.66451e-06

Ubiquinone biosynthesis protein

Pubmed 18495616

 

prodomImg

sp_Pdown

sp|Q3BYB0|COQ7_XANC5

1

217

S=1073 I=95 E=7.97635e-122

2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase EC=1.14.13.- ; Cell membrane Iron Metal-binding Monooxygenase Oxidoreductase Ubiquinone biosyn

sp_Pdown

sp|Q8PQ42|COQ7_XANAC

1

217

S=1064 I=94 E=9.73938e-121

2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase EC=1.14.13.- ; Cell membrane Iron Metal-binding Monooxygenase Oxidoreductase Ubiquinone biosyn

sp_Pdown

sp|Q5GV65|COQ7_XANOR

1

217

S=1030 I=91 E=1.44964e-116

2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase EC=1.14.13.- ; Cell membrane Iron Metal-binding Monooxygenase Oxidoreductase Ubiquinone biosyn

sp_Pdown

sp|Q2NYE2|COQ7_XANOM

1

217

S=1030 I=91 E=1.44964e-116

2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase EC=1.14.13.- ; Cell membrane Iron Metal-binding Monooxygenase Oxidoreductase Ubiquinone biosynthesis

sp_Pdown

sp|Q8PD67|COQ7_XANCP

1

217

S=968 I=85 E=4.59543e-109

2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase EC=1.14.13.- ; Cell membrane Iron Metal-binding Monooxygenase Oxidoreductase Ubiquinone biosyn

Iprscan IPR011566 [PTHR11237]

22

130

Ubiquinone biosynthesis-like protein

Iprscan IPR011566 [PF03232]

58

194

Ubiquinone biosynthesis-like protein

Iprscan [seg]

127

136

-

PD022465

59

217

S=300 I=40 E=6.46685e-29

PD254119

13

58

S=104 I=56 E=4.24433e-05

Iprscan IPR009078 [SSF47240]

47

190

Ferritin/ribonucleotide reductase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1EBlkIOQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

93 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr04850.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr04850.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr04850.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr04850.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ubiE XFF4834R_chr06520
XFF4834R_chr06510
XFF4834R_chr06510
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06530
XFF4834R_chr06530
ID ubiE
AC XFF4834R_chr06520
LT XFF4834R_chr06520
OR XFF4834R_chr from 741481 to 742290 on strand +
DE Ubiquinone/menaquinone biosynthesis methyltransferase
IP UbiE/COQ5 methyltransferase
CL 1.5.3.11 Menaquinone (MK), ubiquinone (Q) GO:0009234 GO:0006744
EC
GO InterPro
Molecular Function: methyltransferase activity (GO:0008168)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100329)
MW 30075.2 Da
SQ 269 aa
 
........10........20........30........40........50
| | | | |
MVRLRSWWRQRCDNPPMSESPYTSGTTHFGFRDVAAKDKQKLVGEVFTSV
ARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGDRVLDLAGGTGDIAVLLK
ERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEALPFPDQ
SFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPI
YDFHSFKILPRLGQLFARDADSYQYLAESIRKHPPQESLKGMMGKAGFAR
CHFKNLTGGIVAIHSGYKI
XFF4834R

XFF4834R_chr29530 lcl|XFF4834R_chr_3392306_3393301_f2_XFF4834R-XFF4834R_chr29530

67

183

S=107 I=31 E=1.60851e-06

XFF4834R

XFF4834R_chr29530 lcl|XFF4834R_chr_3392306_3393301_f2_XFF4834R-XFF4834R_chr29530

67

183

S=107 I=31 E=1.60851e-06

pubmed

26

268

S=753 I=58 E=1.13414e-82

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

Pubmed 1379743

 

prodomImg

pubmed

22

268

S=714 I=55 E=5.57371e-78

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

Pubmed 9821673

 

prodomImg

pubmed

27

267

S=538 I=45 E=1.05321e-56

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

Pubmed 17916642

 

prodomImg

pubmed

43

268

S=495 I=45 E=2.01693e-51

Putative ubiquinone biosynthesis methyltransferase A41 EC=2.1.1.-

Pubmed 8479459

 

prodomImg

pubmed

22

183

S=482 I=57 E=6.8901e-50

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

Pubmed 9922249

 

prodomImg

pubmed

29

264

S=475 I=44 E=5.25389e-49

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

Pubmed 11343129

 

prodomImg

pubmed

32

268

S=438 I=38 E=1.65519e-44

Menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

Pubmed 9515931

 

prodomImg

pubmed

37

268

S=419 I=40 E=3.20552e-42

Menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

Pubmed 9139683

 

prodomImg

pubmed

33

268

S=415 I=35 E=1.01325e-41

Methyltransferase ; Menaquinone biosynthesis

Pubmed 18324396

 

prodomImg

pubmed

43

268

S=400 I=41 E=7.0753e-40

Menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

Pubmed 17194220

 

prodomImg

sp_Pdown

sp|Q8PPP2|UBIE_XANAC

17

269

S=1335 I=99 E=2.09073e-153

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

sp_Pdown

sp|Q8P558|UBIE_XANCP

17

269

S=1324 I=98 E=4.49932e-152

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

sp_Pdown

sp|Q2NYW4|UBIE_XANOM

17

269

S=1324 I=98 E=4.8666e-152

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

sp_Pdown

sp|Q87DI1|UBIE_XYLFT

17

268

S=1123 I=82 E=1.17093e-127

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

sp_Pdown

sp|Q9PD92|UBIE_XYLFA

17

268

S=1117 I=82 E=5.92682e-127

Ubiquinone/menaquinone biosynthesis methyltransferase ubiE EC=2.1.1.-

Iprscan [G3DSA:3.40.50.150]

61

253

-

Iprscan IPR004033 [PTHR10108:SF24]

1

269

UbiE/COQ5 methyltransferase

Iprscan [PTHR10108]

1

269

-

Iprscan IPR004033 [PF01209]

39

268

UbiE/COQ5 methyltransferase

Iprscan IPR004033 [TIGR01934]

43

268

UbiE/COQ5 methyltransferase

PD000198

63

208

S=286 I=43 E=3.84355e-27

PDA23258

4

36

S=172 I=94 E=2.45657e-13

PD008172

202

240

S=150 I=64 E=1.10833e-10

PDA02071

148

201

S=150 I=50 E=1.27425e-10

PD006106

37

71

S=131 I=63 E=2.07287e-08

PD760699

209

268

S=129 I=43 E=4.05634e-08

PDA5Y6F6

43

71

S=110 I=62 E=7.19976e-06

PD947029

85

149

S=107 I=32 E=1.79846e-05

PD120726

66

182

S=106 I=29 E=2.68584e-05

Iprscan [SSF53335]

17

262

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one GD1ST8bq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

49 hits
swiss-prot

Swiss-Prot ncbi-blastp

317 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr06520.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr06520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr06520.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr06520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr08750 XFF4834R_chr08750
XFF4834R_chr08740
XFF4834R_chr08740
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08760
XFF4834R_chr08760
ID XFF4834R_chr08750
AC XFF4834R_chr08750
LT XFF4834R_chr08750
OR XFF4834R_chr from 1016216 to 1017424 on strand +
DE putative 2-octaprenyl-6-methoxyphenol hydroxylase, FAD/NAD(P)-binding
IP Lycopene beta/epsilon cyclase; Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6; 2-polyprenyl-6-methoxyphenol 4-hydroxylase
CL 1.5.3.11 Menaquinone (MK), ubiquinone (Q) GO:0009234 GO:0006744
EC
GO InterPro
Biological Process: carotenoid biosynthetic process (GO:0016117)
Biological Process: ubiquinone biosynthetic process (GO:0006744)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: FAD binding (GO:0050660)
and incorporation of one atom of oxygen (GO:0016709)
with incorporation or reduction of molecular oxygen (GO:0016705)

Curated
PM
AN
CC COG: [CH] Energy production and conversion;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100510)
MW 42614.1 Da
SQ 402 aa
 
........10........20........30........40........50
| | | | |
MTHPHDVLIVGGGLVGSSLAIALDRLGLDVGLVEATPAGAPPAVFDQRNL
SFAAATVNALGALGVMAKLRSPPGPIRRIHVSRAGDFGRVQLDAADYGRD
AFGQVVVARDFGDALQTRLDELTHLRRYRPARCIGIEPVQDDLRAVRLVT
DAGEQRVQANLVVGADGSHSAVRELLHIGTDAHDFLQTLFVARVRASRPP
DGTAWERFGEHGPTALLPRGDRHYGAIHCVARAEAEAVAALDDAGWLARL
QRAAGWRAGRLVASGERSAYPLVQVLANSLIAERVVLLGNAAQTLHPIGA
QGFNLGLRDALTLAELIEHDRSDAGAGALLAEYLARRRVDREHTIGFSSG
LARLTGNPAPLLRPLRSLGLFATSQAAPLQSMLVGGAMGFRGDVPQLCRS
SA
XFF4834R

XFF4834R_chr08760 lcl|visC-XFF4834R_chr08760

27

319

S=249 I=32 E=1.27618e-23

predicted oxidoreductase with FAD/NAD(P)-binding domain

XFF4834R

XFF4834R_chr03400 lcl|XFF4834R_chr03520344_0391528_f2_XFF4834R-XFF4834R_chr03400

263

318

S=95 I=43 E=5.98643e-05

XFF4834R

XFF4834R_chr08760 lcl|visC-XFF4834R_chr08760

27

319

S=249 I=32 E=1.27618e-23

predicted oxidoreductase with FAD/NAD(P)-binding domain

XFF4834R

XFF4834R_chr03400 lcl|XFF4834R_chr03520344_0391528_f2_XFF4834R-XFF4834R_chr03400

263

318

S=95 I=43 E=5.98643e-05

XFF4834R

NP_641224.1 lcl|ubiH-XAC0872

1

402

S=1772 I=88 E=0

2-octaprenyl-6-methoxyphenyl hydroxylase

XFF4834R

YP_362638.1 lcl|ubiH-XCV0907

1

402

S=1756 I=87 E=0

2-octaprenyl-6-methoxyphenyl hydroxylase

XFF4834R

NP_636189.1 lcl|ubiH-XCC0798

1

402

S=1627 I=81 E=0

2-octaprenyl-6-methoxyphenyl hydroxylase

XFF4834R

lcl|XALc_2754

1

401

S=1144 I=64 E=1.73258e-131

probable ubiquinone biosynthesis hydroxylase protein

XFF4834R

lcl|XALc_2753

27

319

S=298 I=34 E=5.78233e-29

probable ubiquinone biosynthesis hydroxylase protein

XFF4834R

NP_641225.1 lcl|visC-XAC0873

27

317

S=262 I=33 E=1.55709e-24

2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase

XFF4834R

YP_362639.1 lcl|ubif-XCV0908

27

317

S=250 I=32 E=4.20352e-23

2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase

XFF4834R

NP_636190.1 lcl|visC-XCC0799

46

320

S=244 I=34 E=2.4892e-22

2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinolhydroxylase

XFF4834R

NP_637995.1 lcl|visC-XCC2647

156

317

S=226 I=36 E=3.09027e-20

hypothetical protein

pubmed

28

390

S=428 I=34 E=4.8892e-43

2-octaprenyl-6-methoxyphenol hydroxylase EC=1.14.13.- ; FAD Flavoprotein Monooxygenase Oxidoreductase Ubiquinone biosynthesis

Pubmed 1339425

 

prodomImg

pubmed

34

399

S=198 I=25 E=3.34069e-15

Protein visC EC=1.-.-.- ; FAD Flavoprotein Monooxygenase Oxidoreductase

Pubmed 1339425

 

prodomImg

pubmed

39

317

S=175 I=26 E=2.0273e-12

2-octaprenyl-6-methoxyphenol hydroxylase Oxidoreductase UbiH/COQ6 family EC=1.-.-.-

Pubmed 10858449

 

prodomImg

pubmed

45

218

S=172 I=34 E=5.15315e-12

UbiH-like protein

Pubmed 8763942,9720864

 

prodomImg

pubmed

153

313

S=143 I=32 E=1.35297e-08

Monooxygenase

Pubmed 17981978

 

prodomImg

sp_Pdown

sp|P25534|UBIH_ECOLI

28

390

S=428 I=34 E=3.3648e-43

2-octaprenyl-6-methoxyphenol hydroxylase EC=1.14.13.- ; FAD Flavoprotein Monooxygenase Oxidoreductase Ubiquinone biosynthesis

sp_Pdown

sp|P72835|Y1300_SYNY3

27

397

S=263 I=25 E=2.80389e-23

Uncharacterized protein slr1300 ; FAD Flavoprotein Monooxygenase Oxidoreductase

sp_Pdown

sp|P75728|UBIF_ECOLI

46

390

S=236 I=26 E=5.23965e-20

2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase EC=1.14.13.- ; FAD Flavoprotein Monooxygenase Oxidoreductase Ubiquinone biosynthesis

sp_Pdown

sp|P25535|VISC_ECOLI

34

399

S=198 I=25 E=2.2991e-15

Protein visC EC=1.-.-.- ; FAD Flavoprotein Monooxygenase Oxidoreductase

sp_Pdown

sp|P53318|COQ6_YEAST

262

384

S=111 I=26 E=8.28577e-05

Ubiquinone biosynthesis monooxygenase COQ6 EC=1.14.13.- ; FAD Flavoprotein Membrane Mitochondrion inner Oxidoreductase

PDA1S896

66

109

S=222 I=100 E=2.25362e-19

PD869018

339

402

S=190 I=75 E=1.42736e-15

PD869496

110

139

S=132 I=80 E=1.79568e-08

PDA4A3O6

41

65

S=118 I=96 E=7.96817e-07

PD867897

76

179

S=112 I=28 E=4.24979e-06

PD009774

179

271

S=112 I=31 E=4.80152e-06

PD000900

284

323

S=103 I=54 E=5.23457e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one U3or1mnP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr08750.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr08750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr08750.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr08750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr08760 XFF4834R_chr08760
XFF4834R_chr08750
XFF4834R_chr08750
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08770
XFF4834R_chr08770
ID XFF4834R_chr08760
AC XFF4834R_chr08760
LT XFF4834R_chr08760
OR XFF4834R_chr from 1017421 to 1018602 on strand +
DE putative 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
IP FAD dependent oxidoreductase; Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6, conserved site
CL 1.5.3.11 Menaquinone (MK), ubiquinone (Q) GO:0009234 GO:0006744
EC
GO InterPro
Biological Process: ubiquinone biosynthetic process (GO:0006744)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: FAD binding (GO:0050660)
and incorporation of one atom of oxygen (GO:0016709)

Curated
PM
AN
CC COG: [CH] Energy production and conversion;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100510)
MW 42513.9 Da
SQ 393 aa
 
........10........20........30........40........50
| | | | |
MSRRSTREAVIVGGGVVGAACALALNDAGLRVALVEGREPARWNADQPDL
RVYAFAADNAALLDSLGVWNAVRAARVQPYRRMRVWDAGGGGELGFDADT
LGREQLGWIIENDVLVDRLWAAVHAAGIEVRCPARVVELEQDAASMRLRL
DDGSRLEAAMAIAADGAASTLRELAGLPVSRHAYAQRGVVAFVETEHPHQ
ATAWQRFLTTGPLAFLPFADGRSSIVWTLPDADAERVLALDDADFSRELT
QAFAARLGEVRVVSARTAFPLQRQLVQQYVSGRMLTLGDAAHVVHPLAGQ
GVNLGLRDVAALRQSVREAMAKRADWAAPHRLQRWARTRRSENTVAAYGF
DAINTVFSNDDMHLTLLRGSVLGLAGKLPPLVDVLWKRASGGA
XFF4834R

XFF4834R_chr08750 lcl|ubiH-XFF4834R_chr08750

23

345

S=283 I=33 E=1.2241e-27

2-octaprenyl-6-methoxyphenol hydroxylase, FAD/NAD(P)-binding

XFF4834R

XFF4834R_chr31630 lcl|XFF4834R_chr34190819_3634090_r3_XFF4834R-XFF4834R_chr31630

222

385

S=113 I=31 E=4.11586e-07

XFF4834R

XFF4834R_chr08750 lcl|ubiH-XFF4834R_chr08750

23

345

S=283 I=33 E=1.2241e-27

2-octaprenyl-6-methoxyphenol hydroxylase, FAD/NAD(P)-binding

XFF4834R

XFF4834R_chr31630 lcl|XFF4834R_chr34190819_3634090_r3_XFF4834R-XFF4834R_chr31630

222

385

S=113 I=31 E=4.11586e-07

XFF4834R

NP_641225.1 lcl|visC-XAC0873

1

393

S=1820 I=92 E=0

2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase

XFF4834R

YP_362639.1 lcl|ubif-XCV0908

1

393

S=1785 I=90 E=0

2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase

XFF4834R

NP_636190.1 lcl|visC-XCC0799

31

393

S=1554 I=84 E=0

2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinolhydroxylase

XFF4834R

lcl|XALc_2753

1

391

S=1218 I=66 E=2.07402e-140

probable ubiquinone biosynthesis hydroxylase protein

XFF4834R

NP_637995.1 lcl|visC-XCC2647

25

381

S=367 I=30 E=2.99471e-37

hypothetical protein

XFF4834R

NP_641224.1 lcl|ubiH-XAC0872

23

345

S=307 I=33 E=4.93666e-30

2-octaprenyl-6-methoxyphenyl hydroxylase

XFF4834R

NP_636189.1 lcl|ubiH-XCC0798

23

391

S=306 I=32 E=7.37247e-30

2-octaprenyl-6-methoxyphenyl hydroxylase

XFF4834R

YP_362638.1 lcl|ubiH-XCV0907

23

345

S=306 I=33 E=7.43702e-30

2-octaprenyl-6-methoxyphenyl hydroxylase

XFF4834R

lcl|XALc_2754

23

349

S=299 I=33 E=4.84728e-29

probable ubiquinone biosynthesis hydroxylase protein

XFF4834R

NP_641673.1 lcl|XAC1338-XAC1338

222

385

S=116 I=31 E=7.48889e-07

oxidoreductase

XFF4834R

YP_363121.1 lcl|XCV1390

222

349

S=115 I=33 E=9.23195e-07

putative monooxygenase

XFF4834R

NP_636661.1 lcl|XCC1287

222

385

S=109 I=31 E=4.71378e-06

oxidoreductase

XFF4834R

NP_635751.1 lcl|pobA-XCC0356

241

314

S=107 I=39 E=9.4687e-06

4-hydroxybenzoate 3-monooxygenase

pubmed

25

391

S=534 I=37 E=5.46636e-56

Protein visC EC=1.-.-.- ; FAD Flavoprotein Monooxygenase Oxidoreductase

Pubmed 1339425

 

prodomImg

pubmed

25

391

S=411 I=31 E=4.86206e-41

2-octaprenyl-6-methoxyphenol hydroxylase EC=1.14.13.- ; FAD Flavoprotein Monooxygenase Oxidoreductase Ubiquinone biosynthesis

Pubmed 1339425

 

prodomImg

pubmed

23

392

S=256 I=23 E=2.71523e-22

Predicted quinone biosynthesis monooxygenase

Pubmed 10988064

 

prodomImg

pubmed

23

312

S=252 I=30 E=8.43436e-22

2-octaprenyl-6-methoxyphenol hydroxylase Oxidoreductase UbiH/COQ6 family EC=1.-.-.-

Pubmed 10858449

 

prodomImg

pubmed

51

253

S=246 I=30 E=5.40229e-21

Ubiquinone biosynthesis monooxygenase COQ6 EC=1.14.13.- ; FAD Flavoprotein Oxidoreductase Polymorphism

Pubmed 10810093

 

prodomImg

pubmed

265

390

S=160 I=33 E=1.19484e-10

Ubiquinone biosynthesis monooxygenase COQ6 EC=1.14.13.- ; FAD Flavoprotein Oxidoreductase Polymorphism

Pubmed 10810093

 

prodomImg

pubmed

24

228

S=223 I=31 E=2.68268e-18

UbiH-like protein

Pubmed 8763942,9720864

 

prodomImg

pubmed

23

156

S=217 I=39 E=1.4308e-17

YleB protein

Pubmed 10572129

 

prodomImg

pubmed

248

392

S=155 I=27 E=4.77929e-10

Ubiquinone biosynthesis monooxygenase COQ6 EC=1.14.13.- ; FAD Flavoprotein Membrane Mitochondrion inner Oxidoreductase

Pubmed 12721307,9133741

 

prodomImg

pubmed

169

227

S=113 I=38 E=6.80451e-05

Ubiquinone biosynthesis monooxygenase COQ6 EC=1.14.13.- ; FAD Flavoprotein Membrane Mitochondrion inner Oxidoreductase

Pubmed 12721307,9133741

 

prodomImg

sp_Pdown

sp|P25535|VISC_ECOLI

25

391

S=534 I=37 E=3.76276e-56

Protein visC EC=1.-.-.- ; FAD Flavoprotein Monooxygenase Oxidoreductase

sp_Pdown

sp|P75728|UBIF_ECOLI

23

374

S=513 I=36 E=1.28433e-53

2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase EC=1.14.13.- ; FAD Flavoprotein Monooxygenase Oxidoreductase Ubiquinone biosynthesis

sp_Pdown

sp|P25534|UBIH_ECOLI

25

391

S=411 I=31 E=3.34679e-41

2-octaprenyl-6-methoxyphenol hydroxylase EC=1.14.13.- ; FAD Flavoprotein Monooxygenase Oxidoreductase Ubiquinone biosynthesis

sp_Pdown

sp|P72835|Y1300_SYNY3

24

380

S=405 I=30 E=1.81639e-40

Uncharacterized protein slr1300 ; FAD Flavoprotein Monooxygenase Oxidoreductase

sp_Pdown

sp|Q9VMQ5|COQ6_DROME

31

391

S=342 I=30 E=6.85498e-33

Putative ubiquinone biosynthesis monooxygenase COQ6 EC=1.14.13.- ; FAD Flavoprotein Oxidoreductase

PD251591

341

391

S=249 I=94 E=1.16189e-22

PD009774

184

270

S=245 I=53 E=3.27913e-22

PD274541

47

123

S=192 I=50 E=8.0794e-16

PDA8V6B3

202

320

S=163 I=29 E=2.82845e-12

PD000900

281

320

S=110 I=54 E=7.40754e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 85367KUE)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

21 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr08760.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr08760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr08760.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr08760.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr17280121_1854690_r1_XFF4834R-XFF4834R_chr16060 XFF4834R_chr16060
XFF4834R_chr16050
XFF4834R_chr16050
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16070
XFF4834R_chr16070
ID XFF4834R_chr17280121_1854690_r1_XFF4834R-XFF4834R_chr16060
AC XFF4834R_chr16060
LT XFF4834R_chr16060
OR XFF4834R_chr from 1854121 to 1854690 on strand -
DE putative secreted lipid/polyisoprenoid-binding, YceI like protein
IP Lipid/polyisoprenoid-binding, YceI-like; Protein kinase, ATP binding site
CL 1.5.3.11 Menaquinone (MK), ubiquinone (Q) GO:0009234 GO:0006744
EC
GO InterPro
Biological Process: protein amino acid phosphorylation (GO:0006468)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: protein kinase activity (GO:0004672)

Curated
PM
AN Tres bons hits blastx ncbi pour conserved hypothetical protein ; protein secrete d'apres signal p3 ; 1 dom interpro pour famille YceI (UPF0312) presente chez E coli MAIS avec I=38% et PCS=PCQ=47% seulement (pas preuve fonctionnelle) ; role de YceI dans isoprenoid quinone metabolism, transport, storage.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20101014)
MW 19793.4 Da
SQ 189 aa
 
........10........20........30........40........50
| | | | |
MSSKLFVSPLLVAASLVATFAAAPVLAADYVQAPGSSLVFASKYDGEVFT
GKFPGFDTTLSFDPANLAGAKLDVRIPLASAVSGNNDRDSTLQGPDFFNV
AKFATARYRADKFRALGGNQYAADGTLELRGVSKPVTLTFTWTPGAQPVL
VGKAVVKRLDFGVGGGDWADTKTIPNETAISTKVVLKAK
XFF4834R

XFF4834R_chr05520 lcl|XFF4834R_chr05710702_0629445_f1_XFF4834R-XFF4834R_chr05520

50

164

S=149 I=33 E=7.09631e-12

predicted protein

XFF4834R

XFF4834R_chr16080 lcl|XFF4834R_chr17290260_1855922_r2_XFF4834R-XFF4834R_chr16080

36

141

S=130 I=32 E=1.31568e-09

XFF4834R

NP_643343.1 lcl|XAC3034-XAC3034

1

189

S=854 I=89 E=9.00938e-97

hypothetical protein

XFF4834R

YP_364902.1 lcl|XCV3171

1

189

S=853 I=89 E=1.39322e-96

putative secreted protein

XFF4834R

NP_638199.1 lcl|XCC2851

1

189

S=802 I=84 E=2.27864e-90

hypothetical protein

XFF4834R

lcl|XALc_2177

29

189

S=693 I=83 E=3.51619e-77

putative ycei-like protein

XFF4834R

YP_362319.1 lcl|XCV0588

50

164

S=149 I=33 E=2.5842e-11

putative secreted protein

XFF4834R

NP_640908.1 lcl|XAC0555-XAC0555

50

164

S=149 I=33 E=2.72299e-11

hypothetical protein

XFF4834R

NP_638952.1 lcl|XCC3606

50

164

S=142 I=32 E=1.64084e-10

hypothetical protein

XFF4834R

lcl|XALc_0331

50

163

S=137 I=30 E=6.7962e-10

conserved hypothetical protein.

XFF4834R

YP_364900.1 lcl|XCV3169

36

141

S=130 I=32 E=4.70837e-09

hypothetical protein

XFF4834R

NP_643341.1 lcl|XAC3032-XAC3032

36

141

S=129 I=32 E=6.90997e-09

hypothetical protein

pubmed

51

138

S=137 I=38 E=2.37015e-08

Protein yceI ; Periplasm Signal

Pubmed 1840644

 

prodomImg

pubmed

51

138

S=117 I=34 E=6.17399e-06

Small protease

Pubmed 16186360

 

prodomImg

pubmed

31

170

S=117 I=28 E=7.61101e-06

Putative uncharacterized protein

Pubmed 14617179

 

prodomImg

Iprscan IPR007372 [G3DSA:2.40.128.110]

30

186

Lipid/polyisoprenoid-binding, YceI-like

Iprscan IPR007372 [PF04264]

29

187

Lipid/polyisoprenoid-binding, YceI-like

Iprscan IPR007372 [SM00867]

29

187

Lipid/polyisoprenoid-binding, YceI-like

Iprscan IPR017441 [PS00107]

163

187

Protein kinase, ATP binding site

Iprscan [seg]

10

28

-

Iprscan [tmhmm]

5

27

-

PD248206

1

73

S=185 I=51 E=6.09474e-15

PD035852

72

163

S=156 I=37 E=1.97263e-11

PDA526J9

143

187

S=121 I=47 E=3.74797e-07

PDA1T374

165

189

S=116 I=92 E=1.59351e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UuCEUZ9r)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

65 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr16060.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr16060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr16060.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGFvXVt/XFF4834R_chr16060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr17290260_1855922_r2_XFF4834R-XFF4834R_chr16080 XFF4834R_chr16080
XFF4834R_chr16070
XFF4834R_chr16070
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16090
XFF4834R_chr16090
ID XFF4834R_chr17290260_1855922_r2_XFF4834R-XFF4834R_chr16080
AC XFF4834R_chr16080
LT XFF4834R_chr16080
OR XFF4834R_chr from 1855260 to 1855922 on strand -
DE putative secreted Lipid/polyisoprenoid/binding, YceI like protein.
IP Lipid/polyisoprenoid-binding, YceI-like
CL 1.5.3.11 Menaquinone (MK), ubiquinone (Q) GO:0009234 GO:0006744
EC
GO InterPro


Curated
PM
AN Tres bons hits blastx ncbi pour conserved hypothetical protein ; protein secrete d'apres signal p3 ; 1 dom interpro pour famille YceI (UPF0312 ; role de YceI dans isoprenoid quinone metabolism, transport, storage.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20101014)
MW 23292.9 Da
SQ 220 aa
 
........10........20........30........40........50
| | | | |
MTILARLLVSSALVATSLAATAAPARYALDPVHTRVLFAVEHAGFSKALG
TVSGSSGTLVFDPDDWAAARLDVTVPLHRADLGDAKWNQATLARNLLDAE
RFPDAHFVSTHVEASGENHAKVTGNLTLHGVTRPVTLEVTLNALKRHPLP
PFRRTAGFSATATLSRAEFGIDAWKSMIGDSVELRIEAEAVREGRADDQT
PEPQAAPTTPGSAANQESGT
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr05520 lcl|XFF4834R_chr05710702_0629445_f1_XFF4834R-XFF4834R_chr05520

30

192

S=300 I=40 E=5.19754e-30

predicted protein

XFF4834R

XFF4834R_chr16060 lcl|XFF4834R_chr17280121_1854690_r1_XFF4834R-XFF4834R_chr16060

34

140

S=129 I=32 E=2.33022e-09

XFF4834R

NP_643341.1 lcl|XAC3032-XAC3032

30

220

S=896 I=92 E=1.1645e-101

hypothetical protein

XFF4834R

YP_364900.1 lcl|XCV3169

30

220

S=879 I=91 E=1.14246e-99

hypothetical protein

XFF4834R

NP_638197.1 lcl|XCC2849

30

197

S=809 I=93 E=3.34554e-91

hypothetical protein

XFF4834R

lcl|XALc_2175

30

195

S=630 I=72 E=1.59297e-69

conserved hypothetical protein.

XFF4834R

YP_362319.1 lcl|XCV0588

30

192

S=300 I=40 E=1.91586e-29

putative secreted protein

XFF4834R

NP_640908.1 lcl|XAC0555-XAC0555

30

192

S=299 I=40 E=2.36178e-29

hypothetical protein

XFF4834R

NP_638952.1 lcl|XCC3606

30

197

S=296 I=39 E=4.54179e-29

hypothetical protein

XFF4834R

lcl|XALc_0331

30

195

S=294 I=39 E=8.96551e-29

conserved hypothetical protein.

XFF4834R

lcl|XALc_2177

36

195

S=137 I=28 E=8.52193e-10

putative ycei-like protein

XFF4834R

NP_638199.1 lcl|XCC2851

34

140

S=137 I=33 E=9.62829e-10

hypothetical protein

pubmed

33

193

S=210 I=32 E=4.60673e-17

Small protease

Pubmed 16186360

 

prodomImg

pubmed

33

193

S=201 I=33 E=5.62497e-16

Protein yceI ; Periplasm Signal

Pubmed 1840644

 

prodomImg

Iprscan IPR007372 [G3DSA:2.40.128.110]

23

194

Lipid/polyisoprenoid-binding, YceI-like

Iprscan IPR007372 [PF04264]

26

191

Lipid/polyisoprenoid-binding, YceI-like

Iprscan IPR007372 [SM00867]

26

191

Lipid/polyisoprenoid-binding, YceI-like

Iprscan [seg]

4

29

-

Iprscan [seg]

199

210

-

Iprscan [tmhmm]

7

29

-

PD035852

71

178

S=221 I=41 E=2.81137e-19

PD227338

30

74

S=107 I=47 E=1.48324e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL